KEGG   Epidermidibacterium keratini: EK0264_16995
Entry
EK0264_16995      CDS       T06370                                 

Gene name
coaD
Definition
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
eke  Epidermidibacterium keratini
Pathway
eke00770  Pantothenate and CoA biosynthesis
eke01100  Metabolic pathways
eke01240  Biosynthesis of cofactors
Module
eke_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:eke00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EK0264_16995 (coaD)
Enzymes [BR:eke01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     EK0264_16995 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: QHC02517
LinkDB
Position
3545090..3545581
AA seq 163 aa
MRRAACPGSFDPITNGHLDIFERTSQIFDEVVILVTHNPNKKTMFSLDERQDLIREATAH
LDNVVVDSMSGLLVNYATKNNITAVCKGLRVATDFDYEIQMAQMNHKIAGVETLFLTTNP
VHSFISSSLVKEVAKYGGDVRDLLPASAHDALLAKIAEDIASP
NT seq 492 nt   +upstreamnt  +downstreamnt
atccggcgcgcggcctgtcccggctcgttcgacccgatcaccaacgggcacctggacatc
ttcgagcgcacgtcgcagatcttcgacgaggtcgtcatcctcgtcacgcacaaccccaac
aagaagacgatgttcagtctcgacgagcgccaggacctgatccgcgaggccacggctcac
ctggacaacgtcgtggtggactcgatgtcggggctgctggtcaactacgccaccaagaac
aacatcaccgccgtgtgcaagggcctgcgggtggcgacggacttcgactacgagatccag
atggcccagatgaatcacaagattgccggcgtggaaacgctcttccttacgacgaatccg
gtgcacagtttcatatcctcttctctggttaaggaagtagcgaaatacggcggcgacgtc
cgcgatctgttgccagcatccgcgcacgacgcgctcctagcgaagatcgccgaggacatc
gccagcccctga

DBGET integrated database retrieval system