KEGG   Escherichia coli KO11FL: KO11_00870Help
Entry
KO11_00870        CDS       T02104                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf00061  Fatty acid biosynthesis
ekf00780  Biotin metabolism
ekf01100  Metabolic pathways
ekf01212  Fatty acid metabolism
Module
ekf_M00083  Fatty acid biosynthesis, elongation
ekf_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KO11_00870 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KO11_00870 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ekf01004]
    KO11_00870 (fabZ)
Enzymes [BR:ekf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     KO11_00870 (fabZ)
Lipid biosynthesis proteins [BR:ekf01004]
 Fatty acid synthase
  Component type
   KO11_00870 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AFH15163
LinkDB All DBs
Structure
PDB: 

Position
202618..203073
Genome map
AA seq 151 aa AA seqDB search
MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactaacactcatactctgcagattgaagagattttagaacttctgccgcaccgt
ttcccgttcttactggtggatcgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtctctgtcaatgagccattcttccagggccatttccctggaaaaccgatt
ttcccgggtgtgctgattctggaagcaatggcacaggcaacaggtattctggcgtttaaa
agcgtaggaaaactggaaccgggtgaactgtactacttcgctggtattgacgaagcgcgc
ttcaagcgcccggtcgtgcctggcgatcaaatgatcatggaagtcactttcgaaaaaacg
cgccgcggcctgacccgttttaaaggggttgctctggtcgatggtaaagtagtttgcgaa
gcaacgatgatgtgtgctcgtagccgggaggcctga

DBGET integrated database retrieval system