KEGG   Escherichia coli KO11FL: KO11_11390Help
Entry
KO11_11390        CDS       T02104                                 

Gene name
arnF
Definition
(GenBank) 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
  KO
K12963  undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    KO11_11390 (arnF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ekf01005]
    KO11_11390 (arnF)
Lipopolysaccharide biosynthesis proteins [BR:ekf01005]
 Unusual sugar
  KO11_11390 (arnF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA 7TM-7TMR_HD
Motif
Other DBs
NCBI-ProteinID: AFH17250
LinkDB All DBs
Position
complement(2426831..2427217)
Genome map
AA seq 128 aa AA seqDB search
MGLIWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS
VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF
LPTTKQRY
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgatatggggattattcagcgtcattattgcctcagttgcgcaattaagcctg
ggttttgcggcaagtcatctgccgccgatgacgcacttatgggattttatcgcggctctg
ttagcttttggcctggatgcccggatactgttactcgggctgctgggttatctgctttcc
gttttttgttggtataaaacgctacataaacttgcgctaagcaaagcctatgccttgctc
agtatgagttatgtgctggtatggattgcttcaatggtacttcccggctgggaagggact
ttttcgctgaaagcactactgggagtagcctgtattatgagcgggttgatgctgattttc
ctgcccacgacaaaacaacgttactga

DBGET integrated database retrieval system