KEGG   Escherichia coli KO11FL: KO11_22935
Entry
KO11_22935        CDS       T02104                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ekf  Escherichia coli KO11FL
Pathway
ekf03030  DNA replication
ekf03430  Mismatch repair
ekf03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ekf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    KO11_22935 (holC)
   03430 Mismatch repair
    KO11_22935 (holC)
   03440 Homologous recombination
    KO11_22935 (holC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ekf03032]
    KO11_22935 (holC)
   03400 DNA repair and recombination proteins [BR:ekf03400]
    KO11_22935 (holC)
Enzymes [BR:ekf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     KO11_22935 (holC)
DNA replication proteins [BR:ekf03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     KO11_22935 (holC)
DNA repair and recombination proteins [BR:ekf03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     KO11_22935 (holC)
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AFH19543
LinkDB
Structure
PDB: 
3SXU 1EM8

Position
complement(4861392..4861835)
AA seq 147 aa
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaaaaacgcgacgttctaccttctggacaatgacaccaccgtcgatggcttaagcgcc
gttgagcaactggtgtgtgaaattgccgcagaacgttggcgcagtggtaagcgcgtactc
atcgcctgtgaagatgaaaagcaggcttaccggctggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg
gagatcgcctggccgcaaaaacgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system