KEGG   Escherichia coli KO11FL: EKO11_1109Help
Entry
EKO11_1109        CDS       T01718                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00250  Alanine, aspartate and glutamate metabolism
eko00280  Valine, leucine and isoleucine degradation
eko00410  beta-Alanine metabolism
eko00640  Propanoate metabolism
eko00650  Butanoate metabolism
eko01100  Metabolic pathways
eko01120  Microbial metabolism in diverse environments
Module
eko_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EKO11_1109
   00650 Butanoate metabolism
    EKO11_1109
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EKO11_1109
   00280 Valine, leucine and isoleucine degradation
    EKO11_1109
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EKO11_1109
Enzymes [BR:eko01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EKO11_1109
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     EKO11_1109
Amino acid related enzymes [BR:eko01007]
 Aminotransferase (transaminase)
  Class III
   EKO11_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADX49744
LinkDB All DBs
Structure
PDB: 

Position
complement(1165726..1167006)
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAVPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAGIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIINQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcagttcctcgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaggtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccaggcgat
ttcgccaagaaaacgctgctggttacgaccggttccgaagcggtggaaaacgcggtgaaa
atcgcccgcgccgccacaaaacgtagcggcaccatcgcttttagcggcgcgtaccacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgcctgggcacgtttatcgcgcgctttatccttgcccgctgcacggcatcagtgaa
gatgacgctatcgccagcattcaccgaatttttaaaaatgacgctgcgccggaagatatc
gccgccatcgtgattgaaccggttcagggcgaaggcggtttctacgccgctacgcctgct
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatctcaccacctttgcgaaatccatcgcgggcggcttcccgctggcgggtgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcgggctgggcggcacctatgccggt
aacccgattgcctgcgtggcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagctgaaagatggactgctggcgattgccgaa
aaacacccggagatcggcgacgtacgcgggctgggagcgatgatcgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgggatcgtggcgcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcaaccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system