KEGG   Escherichia coli KO11FL: EKO11_3046Help
Entry
EKO11_3046        CDS       T01718                                 

Definition
(GenBank) Beta-lactamase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00550  Peptidoglycan biosynthesis
eko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EKO11_3046
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eko01002]
    EKO11_3046
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eko01011]
    EKO11_3046
Enzymes [BR:eko01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EKO11_3046
Peptidases [BR:eko01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EKO11_3046
Peptidoglycan biosynthesis and degradation proteins [BR:eko01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EKO11_3046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ADX51633
LinkDB All DBs
Structure
PDB: 

Position
complement(3160867..3162069)
Genome map
AA seq 400 aa AA seqDB search
MTQYSSLLRGLAAGSAFLFLFAPTAFAAEQTVEAPSVDARAWILMDYASGKVLAEGNADE
KLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKDAWATGNPALRGSSVMFLKPGDQVS
VADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTNTTFQTVHGLDAPGQ
FSTARDMALLGKALIHDVPEEYAIHKEKEFTFNKIRQPNRNRLLWSSNLNVDGMKTGTTA
GAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFETVTPIKPDATFVTQ
RVWFGDKSEVNLGAGEAGSVTIPRGQLKNLKASYTLTEPQLTAPLKKGQVVGTIDFQLNG
KSIEQRPLIVMENVEEGGFFGRMWDFVMMKFHQWFGSWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatactcctctctccttcgtggtcttgcagcgggttctgcatttttattcctt
tttgccccaacggcattcgcggcggaacaaaccgttgaagcgccgagcgtggatgcgcgt
gcatggattttaatggattacgccagcggtaaagtgctggcagaaggcaacgcggatgag
aaactggatcccgcgagcctgactaaaatcatgaccagctatgtggttgggcaggcgctt
aaggccgataagattaaactcaccgatatggtgacggtcggtaaagatgcctgggcgacg
ggaaatccggcactgcgtggttcatcggtaatgttcctcaaaccgggcgatcaggtttcg
gtggcagacttgaacaaaggtgtgattatccagtccggtaatgacgcctgtattgcgctg
gccgattacgttgccgggagccaggagtcatttattggtttgatgaatggttatgccaaa
aaactgggtctgaccaacactaccttccagacggtgcacggtctggatgcgccggggcag
ttcagtaccgcgcgcgatatggcattgctgggtaaagcattgatccacgatgtgccggaa
gagtacgccattcataaagagaaagagttcaccttcaacaaaattcgtcagcctaaccgt
aaccgtctgctgtggagcagcaatctgaatgttgatggcatgaagacaggaaccacggca
ggcgcgggatataatctggttgcttcggctacccagggcgatatgcgtttaatctccgta
gtgctgggggcgaaaactgaccgtatccgttttaatgagtctgagaaattattgacctgg
ggtttccgcttctttgaaaccgtgacgccaattaaacctgatgccacctttgtgactcag
cgcgtctggtttggtgataagagcgaagtgaatcttggggcaggtgaagcgggctcagtg
accataccgcgtgggcagctgaaaaacctgaaggcgagctacacgttaacggaaccgcag
cttaccgcaccgctgaaaaaaggtcaggttgtcgggaccattgatttccagcttaacggt
aaatccattgagcagcgtccgctgatcgtgatggaaaatgtggaagagggcggattcttt
ggtcggatgtgggatttcgtgatgatgaaattccatcagtggttcggcagctggttctct
taa

DBGET integrated database retrieval system