KEGG   Escherichia coli KO11FL: EKO11_3155Help
Entry
EKO11_3155        CDS       T01718                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00020  Citrate cycle (TCA cycle)
eko00190  Oxidative phosphorylation
eko00650  Butanoate metabolism
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01120  Microbial metabolism in diverse environments
eko01130  Biosynthesis of antibiotics
eko01200  Carbon metabolism
Module
eko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eko_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EKO11_3155
   00650 Butanoate metabolism
    EKO11_3155
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EKO11_3155
Enzymes [BR:eko01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EKO11_3155
    1.3.5.4  fumarate reductase (quinol)
     EKO11_3155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: ADX51741
LinkDB All DBs
Structure
PDB: 

Position
complement(3285118..3285834)
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggaagaaggtcgcgacatgatgctgctggatgcgcttatc
cagctgaaagagaaagatcccagcctgtcgttccgccgctcctgccgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgatcgatagccgtgataccgagactgacagccgcctcgacggtttgagcgatgca
ttcagtgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcaacgtaatgcgtaa

DBGET integrated database retrieval system