KEGG   Escherichia coli KO11FL: EKO11_3465Help
Entry
EKO11_3465        CDS       T01718                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00730  Thiamine metabolism
eko00790  Folate biosynthesis
eko01100  Metabolic pathways
eko02020  Two-component system
Module
eko_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eko00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EKO11_3465
   00790 Folate biosynthesis
    EKO11_3465
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EKO11_3465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eko04147]
    EKO11_3465
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eko00537]
    EKO11_3465
Enzymes [BR:eko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EKO11_3465
Exosome [BR:eko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EKO11_3465
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eko00537]
 Enzymes
  EKO11_3465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ADX52041
LinkDB All DBs
Structure
PDB: 

Position
complement(3632650..3634065)
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVNDAASLNSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKEGNTLVIVTADHAHASQVVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggattcggaaatt
actgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaactggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcacatgtgacttcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgct
cgtgccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggcaaccgctggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgaac
gatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctgcttggcctg
tttgctgacggcaatatgccagtgcgctggctagggccgaaagcaacgtaccacggcaat
atcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccaacc
ctggcacagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggatttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gagggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccaggttgttgcg
ccggataccaaagcgccgggcctcactcaggcgctaaatactaaagatggcgcagtgatg
gtgatgagttacgggaactctgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system