KEGG   Escherichia coli KO11FL: EKO11_3912Help
Entry
EKO11_3912        CDS       T01718                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
eko  Escherichia coli KO11FL
Pathway
eko02020  Two-component system
eko02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eko00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EKO11_3912
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    EKO11_3912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eko02022]
    EKO11_3912
Two-component system [BR:eko02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   EKO11_3912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADX52483
LinkDB All DBs
Structure
PDB: 

Position
4113248..4113964
Genome map
AA seq 238 aa AA seqDB search
MQTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGK
NGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNLGTVSEERRSVESYKFNGWELDINSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQ
SRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLED
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccccgcacattcttatcgttgaagacgagttggtaacacgcaacacgttgaaa
agtattttcgaagcggaaggctatgatgttttcgaagcgacagatggcgcggaaatgcat
cagatcctctctgaatatgacatcaacctggtgatcatggatatcaatctgccgggtaag
aacggtcttctgttagcgcgtgaactgcgcgagcaggcgaatgttgcgttgatgttcctg
actggccgtgacaacgaagtcgataaaattctcggcctcgaaatcggtgcagatgactac
atcaccaaaccgttcaacccgcgtgaactgacgattcgtgcacgcaacctgctgtcccgt
accatgaatctgggtactgtcagcgaagaacgtcgtagcgttgaaagctacaagttcaat
ggttgggaactggatatcaacagccgttcgttgatcggccctgatggcgagcagtacaag
ctgccgcgcagcgagttccgcgccatgcttcacttctgtgaaaacccaggcaaaattcag
tctcgtgctgaactgctgaagaaaatgaccggccgtgagctgaaaccacacgaccgtact
gtagacgtgacgatccgccgtattcgtaaacatttcgaatctacgccggatacgccggaa
atcatcgccaccatccacggtgaaggttatcgcttctgtggtgatctggaagattaa

DBGET integrated database retrieval system