KEGG   Eutypa lata: UCREL1_1175Help
Entry
UCREL1_1175       CDS       T03103                                 

Definition
(GenBank) putative superoxide dismutase protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ela  Eutypa lata
Pathway
ela04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ela00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    UCREL1_1175
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UCREL1_1175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: EMR71779
UniProt: M7SYS5
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MATSLFRTAPTVRAALRAGSAKPRVAASLAGTSFVRGKATLPDLSYDYGALEPHISGKIM
EIHHKGHHQTYVTNLNAALEQISEAKEKNNEIAAASLASALNFNGGGHTNHTLFWENLAP
NNKGGGGEPEGTLKSAIEKDFGSFDTLKKQITAALAGIQGSGWAWLVKDKTTGALQVVTR
PNQDPVVGNQAPLLGIDAWEHAYYLQYQNRKAEYFSAIWNVINWSTVASRLEKS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcgcttttccgcaccgcccctacagtccgagccgctctgcgagccggttcc
gcgaagccccgtgtcgctgcttcgttagcggggacatcgttcgtccgaggcaaggccaca
ctccccgacctatcatacgactatggcgccctggagccgcacatctccggcaagatcatg
gagatccaccacaagggccaccaccagacctacgtcacgaacctgaacgcggcgctggag
cagatctccgaggccaaggagaagaacaacgagatcgccgccgcctcgctcgcctccgcc
ctcaacttcaacggcggcggccacaccaaccacaccctgttctgggagaacctggccccc
aacaacaaggggggtggtggtgagcccgagggcaccttgaagtccgccatcgagaaggac
ttcggctccttcgacaccctcaagaagcagatcaccgccgccctagccggcatccagggc
agtggctgggcgtggctggtgaaggacaagacgacgggcgcgctgcaggtggtgacgcgc
ccgaaccaggaccccgtcgtcggcaaccaggccccgctgctgggcatcgacgcctgggag
cacgcctactacctgcagtaccagaaccgcaaggccgagtacttcagcgccatctggaac
gtcatcaactggtctaccgtggccagcaggctggagaagtcgtaa

DBGET integrated database retrieval system