KEGG   Eutypa lata: UCREL1_1417Help
Entry
UCREL1_1417       CDS       T03103                                 

Definition
(GenBank) putative glutathione s-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ela  Eutypa lata
Pathway
ela00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UCREL1_1417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ela02000]
    UCREL1_1417
Enzymes [BR:ela01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     UCREL1_1417
Transporters [BR:ela02000]
 Other Transporters
  Pores ion channels [TC:1]
   UCREL1_1417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_N GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-ProteinID: EMR71533
UniProt: M7T3S5
LinkDB All DBs
Position
Unknown
AA seq 293 aa AA seqDB search
MASVDTSLPARTTGAAAAFAAEHAAEHPLKLYGGWFCPFVQRSWIVLHEKNIPHQYVEIN
PYKKAPEFLALNPRGLVPTLAVPVSRDGETQKPLYESAVICEFLDEAFTGDVAAVEGIEG
GGKYGKPLLTEDPYERARCRLWIDHISNKIVPAFYKFIQHTPDKEYSIEQARDNLHTHIK
TFVKEMEDSREGPWFLGQRFSLVDIMLAPWAKRLFLIDHYKPGGVGIPDKDQEGEDKEVW
ARWRTWFEATTNRQSVKDTWSDDEMYIEAYKRYAEDTTQSEVGQATRKGEKLP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggtagatacatcgctcccggcgaggacgacaggcgctgccgcggcattcgca
gccgagcatgccgctgagcacccgctaaagttatatgggggctggttctgtccgtttgtg
cagcgctcgtggatcgtcctgcacgagaagaacatcccgcatcagtatgtcgagatcaac
ccgtacaaaaaggcgcccgagttcctggcgctgaatccacggggtttggtgccaacgctt
gccgttcccgtctctagggatggagagacgcagaagcccctgtacgagagcgccgtgatt
tgcgagttcctcgacgaggcctttactggcgacgttgctgccgtggagggcatagaggga
ggaggaaagtatggcaaacctttattgacagaggatccgtacgagcgtgcgcgatgcagg
ctttggatcgatcacatcagtaacaagattgtcccggccttctacaagttcatacagcac
acccccgacaaggagtatagtattgagcaggcacgggataacctgcatacgcatatcaag
acatttgttaaggagatggaggactcgagggaaggaccatggtttctgggccaaagattc
agtcttgtggacatcatgctagccccctgggctaagcgactcttcctgatcgatcactac
aagcctggcggggtgggcataccggataaggaccaggaaggggaagataaggaggtgtgg
gcgagatggaggacctggtttgaggccaccacgaacagacagagtgtcaaagatacctgg
agtgatgatgagatgtacatcgaggcgtacaagcgatacgcggaggacacaactcaatca
gaagttggtcaggctacgaggaaaggggagaaactgccgtga

DBGET integrated database retrieval system