KEGG   Eutypa lata: UCREL1_2409Help
Entry
UCREL1_2409       CDS       T03103                                 

Definition
(GenBank) putative superoxide dismutase protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ela  Eutypa lata
Pathway
ela04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ela00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    UCREL1_2409
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UCREL1_2409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Med25_VWA
Motif
Other DBs
NCBI-ProteinID: EMR70544
UniProt: M7SVD0
LinkDB All DBs
Position
Unknown
AA seq 215 aa AA seqDB search
MSASTYSLPPLPYAYDALEPSISKQIMELHHTKHHQTYITNLNKALSTSATALSQGNLQD
SQAQLSAIRFNGGGHINHSLFWEGLAPASSPDAQIDSAAPKLKAAIASTWGSVDKFKETF
SAALLGIQGSGWGWLVKEAVTGQLRIVTLANQEAVVVGDTPLFGVDMWEHAYYLQYLNGK
AAYVDNIWKIVNWKTAEARFGGAREDVFKVLKANM
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcctcaacctacagtctgcctccgcttccctacgcatacgatgctctagagccc
agcatttccaagcagatcatggaactacaccacaccaagcaccaccagacgtacatcacg
aacctgaacaaggctctctccacgtccgcgaccgccctctctcagggcaacctgcaagac
tctcaggcccagctctccgcgatccggttcaacggcggcgggcacatcaaccactccttg
ttctgggaaggcctcgcacccgcctcatctcccgacgcgcagatcgacagcgcggccccc
aagctgaaggccgccatcgcgtccacctggggcagcgtcgacaagttcaaggagaccttc
tcggcggcgctgctcggcatccagggcagcggctggggctggctcgtcaaggaggccgtc
acgggccagctgcgcatcgtgaccctcgccaaccaggaggctgtcgtcgtcggcgacacc
ccgctcttcggcgtcgatatgtgggagcacgcctactacctccagtacctcaatggcaag
gccgcctacgtcgacaacatctggaagatcgtcaattggaagacggccgaggcgcgcttc
gggggcgctagagaggatgtcttcaaggtgctgaaggctaacatgtaa

DBGET integrated database retrieval system