KEGG   Eutypa lata: UCREL1_3207Help
Entry
UCREL1_3207       CDS       T03103                                 

Definition
(GenBank) putative dna ligase 1 protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ela  Eutypa lata
Pathway
ela03030  DNA replication
ela03410  Base excision repair
ela03420  Nucleotide excision repair
ela03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ela00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    UCREL1_3207
   03410 Base excision repair
    UCREL1_3207
   03420 Nucleotide excision repair
    UCREL1_3207
   03430 Mismatch repair
    UCREL1_3207
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ela03032]
    UCREL1_3207
   03400 DNA repair and recombination proteins [BR:ela03400]
    UCREL1_3207
Enzymes [BR:ela01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     UCREL1_3207
    6.5.1.6  DNA ligase (ATP or NAD+)
     UCREL1_3207
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     UCREL1_3207
DNA replication proteins [BR:ela03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    UCREL1_3207
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     UCREL1_3207
DNA repair and recombination proteins [BR:ela03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     UCREL1_3207
   NER (nucleotide excision repair)
    Other NER factors
     UCREL1_3207
   MMR (mismatch excision repair)
    Other MMR factors
     UCREL1_3207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C NuDC
Motif
Other DBs
NCBI-ProteinID: EMR69781
UniProt: M7TIK0
LinkDB All DBs
Position
Unknown
AA seq 932 aa AA seqDB search
MPSPSKKRKLNDGSKPTALPSRGLEYFFAKQRKTGNEANANADATGPSNRSSADQELTDE
ELARKLQAEWDQEAAATASHDNAGPASSSHGHKPLSSTSQSPYIGDEIDNGARLTESIPF
DENPLTFEPSKYISQLKDLWESEGGNATYALLTRCFVLINSTTSRIKIVDTLVNCLRVLI
EGDPGSLLPAVWLSTNSISPPYISLELGLGGSAISKALKQACGLDNRSLKAIYDKHGDAG
DVAFEAKKKQSFTLRKPKPLTIKGVYQSLVKIANSQGHGSGEVKQRIVDRLLQDARGGEE
SRYVVRTLCQHLRIGAVKTTMLIALSRAFLLSRPDGAGFPLKSVDELRALKKEELAEVWA
RAEEITKACFARRPNYNDLVPGMLEIGVCEELLIRCDLTLHIPLRPMLGSITRDLSEMLT
KLQGRDFACEFKYDGQRAQVHCDEKGEVSIFSRHLEVMTDKYPDLVELVPKIRGEGVGSF
VMEGEVVAVDRQTGELKNFQTLTNRARKDVAIGSITVDVCLFAFDLMYLNGQPLLDRPFR
ERRELLRSLFVEVPHHFTWVKSLDATSQDADAVLDFFKQATALKCEGIMVKILDNLTDLP
NPAEVLQGRGDDDTDPTPQQEAVESETLSLPKPKKGRGKAKPKTKPAGGNNGDSKEKKAS
SRRKPLLATYEPDKRLDSWLKVKKDYSSSFDTLDLVPVAAWHGSGRKAKWWSPVLLAVRN
EDTGALEAVCKCMSGFTDAFYKSMRRFYDDGSGEEKPENGGGEEGDDYGDTAIAAAQGND
NDNDNGQNKDGEHGDEEEEDESSESGEDNPNPKSTSHSHSSNTRKTQPSFVEYSGPRPDV
WFEPQEVWEVAFADITLSPTYTAAIGLASADRGLSLRFPRFLRKRERADKGVEEASTSEF
LAGLWRKQEAKAVVMPATDASPLEEVEEDGEV
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcccttccaaaaagcggaagctaaatgacggctcgaaaccaactgctctgcct
tctcgcggcttagagtatttctttgctaaacagaggaaaactggcaatgaagcgaatgcg
aatgcggatgcgacaggtccttcgaataggagcagcgctgatcaggagctgacggacgag
gaattggcccggaagctccaggccgagtgggaccaagaggctgccgcgactgcaagccac
gataacgcgggcccagcctcaagttcacatggtcataaacccctatcatcaacatcacaa
agcccttatatcggtgacgaaatagataatggcgccaggcttaccgagtctatccccttt
gatgagaatccacttaccttcgaaccgtctaagtacatatcgcagctgaaggacctctgg
gaaagcgagggcgggaatgcaacgtacgcgctgttgacgcgctgcttcgtgttgataaat
agcacgacgagccgtatcaagatcgtcgataccttggtaaactgcctgcgcgtgctcatc
gagggagacccgggcagtcttctccctgctgtatggctatctacgaactccatctcacca
ccgtacatctcgctagagctaggccttggcggttccgcgatatctaaggcgctgaagcag
gcctgcgggctcgacaatcgctcgctcaaggcgatctacgataaacacggcgatgcggga
gacgttgctttcgaggcgaagaagaagcagagcttcacgctcagaaaacccaaacccttg
actatcaagggcgtttaccagtcgttggttaaaatcgccaatagccagggacacggcagc
ggggaggtgaagcagaggatcgttgataggctactgcaggatgcccggggcggcgaagag
agccgctacgtggtacgcacgctgtgccaacacctccgtatcggcgctgtcaaaacgacc
atgctgatcgccctctcgcgcgcatttcttctctcgcggccggacggcgccgggtttcct
ctgaagtccgtcgacgagctccgggctctcaagaaagaggagcttgccgaggtctgggcg
cgggccgaggagatcaccaaggcctgctttgcgcggcggccgaactacaacgacctcgtc
cccggcatgctcgagatcggcgtgtgcgaggagctcctgatccgctgcgacctgacgttg
cacatccccctccggcccatgctgggcagcatcacccgggatctgtccgagatgctcacg
aagctgcaagggcgcgatttcgcctgcgagttcaagtacgatgggcagcgggcccaggtc
cactgcgacgagaagggggaggtgtcgatcttctcgcggcacctggaggtcatgaccgac
aagtacccggacctcgtcgaacttgtgccgaagatccgtggtgagggcgtgggcagcttc
gtcatggagggcgaggtggtcgcggtggaccggcagaccggggagctgaagaacttccag
acgctgacgaaccgcgcccgcaaggacgtggccatcggcagcataaccgtcgatgtctgc
ctcttcgcctttgacctcatgtacctcaacggccagccgctgctcgaccgcccgttccgc
gagcggagggagctgcttcggtctctgttcgtcgaggttccgcaccactttacttgggtc
aaaagcctcgatgccacatctcaggatgcggatgcggtgctggacttcttcaagcaggct
acagctctgaaatgcgaaggcattatggtcaagatcctcgacaatctaacggacttgcct
aacccggcggaggttcttcagggacgaggagacgacgacaccgatcctaccccgcagcag
gaagccgtcgagagcgaaacgctgagcctaccgaaaccgaaaaagggtcgtggtaaagca
aaacctaaaacgaagccagctggtggcaacaacggcgacagtaaagagaagaaggcgtca
tcgcgccggaaacccctgctagcgacctacgaaccggacaagcgcctcgactcctggctc
aaggtgaagaaggactacagctcctccttcgacaccctagacttagtccctgtcgctgcc
tggcacggatcaggccgcaaggcgaagtggtggtcgccggtgctgctcgccgtgcgcaac
gaagatacgggggccctagaggcggtctgcaagtgcatgtcgggcttcacggatgcgttc
tacaagtccatgaggagattctacgacgatgggtcgggggaagagaaacccgaaaatggt
ggcggagaggagggagatgattacggcgatactgcaatagcagcagcacagggtaatgat
aatgataatgataatggccaaaacaaggatggagagcatggtgacgaggaagaggaagac
gaaagtagtgaaagtggagaagacaaccccaatccaaagtccacaagccacagccacagc
agcaacacgcgcaagacgcagcccagcttcgtagagtactcgggcccgcggccggacgtc
tggttcgagccccaggaagtctgggaggtggcgttcgccgacatcacgctgtcgccgacg
tacacggcggcgatcgggctggcgagcgcggaccgcgggctcagcctgcggttcccgcgg
ttcctgcgcaagagggagagggcggacaagggggttgaggaggcgagcacgagcgagttc
ctcgccggcttgtggcgcaagcaggaggccaaggctgtggtgatgcctgctactgatgcg
tcgccgttggaggaggttgaggaggatggggaggtgtga

DBGET integrated database retrieval system