KEGG   Eutypa lata: UCREL1_4320Help
Entry
UCREL1_4320       CDS       T03103                                 

Definition
(GenBank) putative glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ela  Eutypa lata
Pathway
ela00500  Starch and sucrose metabolism
ela01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UCREL1_4320
Enzymes [BR:ela01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     UCREL1_4320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-ProteinID: EMR68668
UniProt: M7SVZ2
LinkDB All DBs
Position
Unknown
AA seq 646 aa AA seqDB search
MHAFSSLFLLGSYAFQTILGRPEPSRMTQREIVKRAVDDFIATEEPIALEQLLCNIGSTG
CNSNGVSSGIVIASPSTSNPDYFFTWTRDAALVFTSIVERFVHSYDAGLQTEIQNYIASQ
AKLQTVSNPSGSLSDGKGLGEAKYHVDLGAFTDGWGRPQRDGPALRAIAMIGYANWLVAN
GYEDTASNVVWPVIKNDLSYVTQYWNQTGFDLWEEVNGSSFFTTAAQHRSLVEGSALATT
LGKSATDYDAIAPQVLCFLQSFWSPASGYVRANTNVNTGRAERDANVILGSIHTFDPTLG
CDAATFQPCSDRALISHKAIVDSFRSIYNINSAIPSGSAVAVGRYAEDVYYNGNPWYLNT
LAAAEQLYDALYVWQSTGSITVTSTSLSFFTDLVSSATTGTYASGSATYTELYDAVFAYA
DGFIGVVSQYIQSNGSMAEQFDRSSGAPLSARDLTWSYAAFLTAAARRAGVVPPSWASGE
STATSVPGVCSATSRAGTYSTATATSFPASLTPTASSDPTGTSTFTKPTATATTTTAAPC
TTATAVAVTFNVLKTTTFGQTVKIVGNVAALGNWDTTKAVALSASSYTASNPLWKGTVTL
PAGSAVQYKYIVLNTDGTVAWEADPNRSWTVPKTCVTTTSKSDTWQ
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccttcagttctctcttcctgctcggaagctatgccttccaaacgatcctcggc
cgaccggagccatctcgcatgacgcagcgcgagatcgtgaagcgagcagtcgatgatttc
atcgccaccgaggagcccatcgctctggaacagctgttatgtaacatcggatctactggg
tgcaactccaatggcgtaagctcggggatcgtcattgcatccccgtcgacctcaaaccct
gactacttcttcacctggacccgagacgccgctctcgttttcacgtcgattgtggaaagg
tttgtccactcctatgatgccggtcttcagacagagatccagaactacatcgcctcgcag
gccaagctgcagaccgtatccaacccgtcgggctcgctgtccgatggtaagggtctcggg
gaggcgaagtaccacgttgatctgggcgccttcaccgatggttggggccgtccccaacgc
gatggacccgcgcttcgagccatcgccatgatcggttatgccaactggttagttgccaac
ggttacgaggacactgcatccaacgtcgtctggcctgttatcaaaaacgatctttcctac
gttacccagtactggaaccagaccggcttcgacctctgggaagaagtaaatggaagctca
ttcttcaccaccgccgcccaacatcgttccctcgttgagggtagcgctttagccacaacc
ctaggcaaatccgctaccgattacgatgccatcgcccctcaagttctgtgcttcctgcag
tcgttctggtcgccggcgtccggttatgtccgggccaacaccaacgtcaacaccgggaga
gccgagagagacgccaatgtcatcttaggatctatccacacctttgacccgacccttggc
tgcgatgctgccaccttccaaccgtgtagtgatcgggccctcattagccacaaggccatc
gttgattccttccggagcatctacaacatcaactcggcgatccccagtggctcggctgtt
gccgtgggacgatacgcagaagacgtgtactacaatggtaacccctggtacctcaacacg
ctcgcagcggcagagcagctctacgacgcgctctacgtatggcaatcaaccgggtcgatc
accgtaacctcgacatcgctatccttcttcacggacctagtcagctccgccacgaccggg
acctacgcctccggctcggcgacctacacggagctgtacgacgccgtgttcgcctacgcc
gacggcttcatcggcgtcgtctcccagtacatccaatcgaacgggtcgatggccgagcaa
ttcgaccggtcctccggagcgccgctctcggcgcgcgacctcacctggtcgtacgccgcg
ttcctgacggccgcggcgcgccgcgccggcgtcgtcccgcctagctgggccagcggtgag
tcgaccgccacgtcagtgccgggcgtgtgctcggcgacctcgcgggccgggacgtactcg
acggcgacggcgacttcgttccccgcgagcttgacgccgacggcgagcagcgatcccacc
gggaccagcacgttcacgaaacccaccgcgacggcgacgaccaccaccgcggcgccctgc
acgacggcgacagcagtggccgtgaccttcaacgtgctgaagacgacgacgtttggccag
acggtcaaaatcgtggggaatgtggcggcgctgggcaactgggacacgacgaaggcggtg
gcgctgagcgcgtcgagctacacggccagcaatccgctctggaagggcaccgtgacgctc
cctgcgggctccgctgttcagtataagtatatcgttctgaacacggacggcacggtcgcg
tgggaggcggatccaaatcggtcgtggacggtgccgaagacgtgcgtgacgactacgtcg
aagtcggatacctggcagtag

DBGET integrated database retrieval system