KEGG   Eutypa lata: UCREL1_512Help
Entry
UCREL1_512        CDS       T03103                                 

Definition
(GenBank) putative dna repair protein rad32 protein
  KO
K10865  double-strand break repair protein MRE11
Organism
ela  Eutypa lata
Pathway
ela03440  Homologous recombination
ela03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ela00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    UCREL1_512
   03450 Non-homologous end-joining
    UCREL1_512
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ela03032]
    UCREL1_512
   03400 DNA repair and recombination proteins [BR:ela03400]
    UCREL1_512
DNA replication proteins [BR:ela03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     UCREL1_512
DNA repair and recombination proteins [BR:ela03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     UCREL1_512
    BRCA1-C complex
     UCREL1_512
   NHEJ (non-homologous end-joining)
    MRX complex
     UCREL1_512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: EMR72449
UniProt: M7T0L1
LinkDB All DBs
Position
Unknown
AA seq 720 aa AA seqDB search
MSSSQFTEADTIRILVATDNHVGYQEDHQFRGDDSWKAFDEIMQLARTEDVDMVLLGGDL
FHDHNPSRKSVFQVMRSLRKNCLGMKPCELQFLSDADQVFGGAFGHVNYEDQDINVSIPV
FSIHGNHDEPSGTGNCCSLELLDVGGLMNYFGRVSNVDDIHAKPVLLQKGQTKLALYGIS
HVRDERMFHTFKDQKVTWYKPNVQPKDWFNLLTVHQNQLNTNTGFHVLQPGSSVATSLVP
AEAEPKYVAVVSITGKSFEVEKHRLKSVRPFILEDITLRDLPQFKGLERQKENRIEITRR
LMVIVEDMIKKANADWEALQGEDFDPSLKLPLIRLKVEYTAPEGGHYDVENPQRFSQRFN
NRVANSNDVVHFWRQKRLTKREKADKPSEEALAELELDLGEIKVKELVDEFLAAQSLKIL
PQAPFGDAVNQFVIDDDRHAMEAFVAQSLEEQVQQMMSLEEKEGDDDLTNEMEKYKNRVE
KQFAIGNFKRAQRRKLKPKPNGWDSDMEGHWEDQPQAVDLAGTIADQAESTQPKGRGRKA
PAKKIVRSEDEDDDMDDMLEETPAPKPKGRGRPAASTTKAKPAPAKAPAKKAPAKTPARG
GRGRKAQVFLDDSDEEEEEEADVMMEDDDDDPPAPPPRRAAASRAAPKAAATPAASTSRS
QPARGRAAAAAAAAAAPKARQTKLNFSQAASQQKAVELSDDEISDDDAFESIPTTRSRKR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcttcacagttcaccgaagctgatacgatacgcatcctggtcgccacagataac
catgttggctaccaagaggatcaccagttccgtggggatgatagctggaaggcatttgac
gagatcatgcagttagcacgaacagaagacgttgacatggttctgctcggaggtgacctc
tttcatgaccacaatccgtctagaaaatccgtgttccaggtcatgagatcgctgcggaag
aattgtcttggcatgaaaccatgcgagttgcagttcctgagtgacgcagatcaagtcttt
gggggtgcctttggtcatgtcaactacgaagaccaggatattaacgtatccattcccgtc
ttctccatccacggaaaccacgatgagccaagtggaactgggaactgctgttccttggaa
cttctcgacgttggcggactaatgaactatttcggccgtgtctcgaacgtcgatgacatc
catgctaaaccagtcctcctacagaaaggtcagacaaaacttgctctttatgggataagc
cacgtacgagacgaacgcatgtttcacacctttaaagaccagaaagtcacatggtacaaa
ccgaatgtgcagccaaaagattggttcaacctgcttaccgtccatcaaaaccaactaaat
accaacactggatttcatgtcttgcagcctggctcttcggtcgctacatctctagttccc
gccgaggcagaaccaaagtacgtggctgttgtcagcattaccggcaagagtttcgaggtt
gagaagcaccgcctaaagtccgtccgcccgttcattttggaggatatcacccttcgcgat
ttaccccaattcaagggcctcgagcggcaaaaagagaaccggatagagattacgagacga
cttatggtgattgtagaagatatgattaagaaagctaatgccgactgggaggcactacag
ggagaagatttcgacccttcactgaaactacctttgatacgtctgaaggttgagtatact
gctcccgaaggaggtcattacgacgtggagaacccacaacgattttcacagcgcttcaac
aatagagtggcaaatagcaacgatgttgtccatttctggcggcagaagagattgacaaaa
agggagaaggcagataagccctctgaggaagcactagcagagctggagctcgaccttggt
gaaataaaagtcaaggagctcgtcgatgagtttctcgccgctcaatccttgaagatactg
cctcaagcaccttttggagatgcagttaaccagttcgtcattgatgatgatagacatgct
atggaagccttcgtcgctcaatcactcgaagaacaagtacagcagatgatgtcgctagaa
gaaaaggaaggagacgacgatttgaccaacgaaatggagaaatacaaaaacagggtcgag
aagcagttcgccatcggtaacttcaaacgagcccagaggaggaagttgaagccgaagccg
aacggatgggactccgatatggaaggccactgggaggaccagccccaagcagtcgacctc
gcagggactatagcagaccaggcggagtctacccaacccaaaggccggggccgcaaggct
cccgccaagaagattgtccgaagtgaagatgaggacgatgacatggatgatatgttagag
gagacccccgcaccgaagccgaaaggcagaggaaggccagcggcttccactacgaaagct
aagcccgcaccggccaaagcgccggccaagaaagctcccgcgaaaactccagccagaggg
ggacggggccggaaggcacaggtcttcctagacgatagtgacgaggaagaggaagaggag
gcggacgtcatgatggaagacgacgacgacgacccgcctgccccgccgccgagacgcgca
gcggcttcgagagcagcaccaaaagcagcagcaacgccggctgctagtactagtagatcg
caaccggcacggggtcgggctgcggcggcggcggcggcggctgctgcaccaaaggcgcgg
cagacgaaacttaatttctcccaggcggcgtcgcagcagaaggctgtggagctcagcgac
gatgagatctcggacgatgacgctttcgagtccatcccgacgactaggagtcgtaagcgt
tga

DBGET integrated database retrieval system