KEGG   Eutypa lata: UCREL1_5434Help
Entry
UCREL1_5434       CDS       T03103                                 

Definition
(GenBank) putative hexokinase protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ela  Eutypa lata
Pathway
ela00010  Glycolysis / Gluconeogenesis
ela00051  Fructose and mannose metabolism
ela00052  Galactose metabolism
ela00500  Starch and sucrose metabolism
ela00520  Amino sugar and nucleotide sugar metabolism
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
ela01130  Biosynthesis of antibiotics
ela01200  Carbon metabolism
Module
ela_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ela_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UCREL1_5434
   00051 Fructose and mannose metabolism
    UCREL1_5434
   00052 Galactose metabolism
    UCREL1_5434
   00500 Starch and sucrose metabolism
    UCREL1_5434
   00520 Amino sugar and nucleotide sugar metabolism
    UCREL1_5434
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UCREL1_5434
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ela04131]
    UCREL1_5434
Enzymes [BR:ela01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     UCREL1_5434
Membrane trafficking [BR:ela04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    UCREL1_5434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: EMR67559
UniProt: M7SME9
LinkDB All DBs
Position
Unknown
AA seq 490 aa AA seqDB search
MPRKPPSRKGSMADVPKDLLQEIKKLEELLTVDTAKLKQMTKHFVSELDKGLSVEGGSIP
MNPTWVMAFPDGYETGTFLALDMGGTNLRVCEITLTDVKSEFDIIQSKYRMPEELKTGDA
DELWDYIADCLQQFIETHHPDLPANVKLPLGFTFSYPATQNYIDEGILQRWTKGFDIDGV
EGKNVVPMLEKALNEKNVPIKVSAVINDTTGTMIASAYTDPKMKIGCIFGTGCNAAYMEN
CGSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTNYDILIDKDSPRPGQQAFEKMIA
GLYLGEIFRLILVDLHDNKDVHMFEGQDIKRLRKPYSLDSSFLSAIEDDPFENLQETQDL
IQDKLHISCTRPELELIRRAAELIGTRAARLSACGIAAICTKKQYETAHVGADGSVFNKY
PHFKARGAQALREILDWPAKKTGSGSGEDPVEVLAAEDGSGVGAALIAALTLKRVHDGNL
AGILHPENFK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgaaagcctccttcccgaaagggttctatggccgatgtgcccaaggatctcttg
caggagatcaagaagttggaggaactgctgaccgttgacactgctaagctcaagcaaatg
accaagcactttgtttctgagcttgacaagggtttgagcgttgagggaggcagtatcccc
atgaacccaacatgggttatggcattcccggacggctatgagacgggcacattcttggct
ctggacatgggtggcaccaatctccgtgtttgcgagattaccctgacagatgtgaagtcg
gagttcgatataatccagtctaaataccgcatgcctgaggagctgaagacgggtgatgcc
gatgaactctgggactatattgccgactgtctgcagcagttcatcgagacccaccaccct
gacctccccgcaaacgtcaagctacccctaggtttcactttctcttacccagctacccag
aactacattgatgagggtattctccagcgctggaccaagggttttgatattgatggggtg
gagggtaagaacgttgttccaatgctcgagaaggccttgaacgagaagaatgtacccatc
aaagtgtctgctgtgatcaacgatactacaggtactatgattgcctctgcttacaccgac
ccgaaaatgaagattggttgcatcttcggtaccggttgcaacgcggcttacatggagaac
tgcggttctatccccaagctcgcccatatgaatctgccccccgacacacctatggccatc
aactgcgagtggggcgccttcgataacgaacacaaggtcttgcctcggaccaactacgac
atccttatcgacaaggactctccccgaccgggccagcaggcgttcgagaagatgatcgcc
ggtctgtacctcggcgagatcttccgattgatcttggtagacctgcacgacaacaaggac
gtccacatgttcgagggccaggacatcaagcgcttacgaaagccctacagtctcgactcg
tccttcctgtcggccattgaggacgaccccttcgagaacctgcaggagacgcaggacctc
atccaggacaagctgcacatcagctgcacgcgcccggagctcgagctgatccggcgggcc
gcagagctgatcggcacgcgggcggcacggctgtcggcgtgcggcatcgcggccatctgc
accaagaagcagtacgagacggctcacgtgggcgccgacgggtccgtcttcaacaagtac
ccacacttcaaggcgcgcggggcccaggcgcttcgtgagatcctcgactggccggccaag
aagactggcagcggcagcggtgaggaccccgtcgaggtcctagccgccgaggacggcagc
ggtgtcggcgccgccctgatcgccgccctcacgctcaagcgcgtccacgatgggaacctc
gccggcatcctgcacccggagaacttcaaatga

DBGET integrated database retrieval system