KEGG   Eutypa lata: UCREL1_6140Help
Entry
UCREL1_6140       CDS       T03103                                 

Definition
(GenBank) putative elongation factor tu protein
  KO
K02358  elongation factor Tu
Organism
ela  Eutypa lata
Brite
Translation factors [BR:ela03012]
 Eukaryotic Type
  Elongation factors
   UCREL1_6140
 Prokaryotic Type
   UCREL1_6140
Mitochondrial biogenesis [BR:ela03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    UCREL1_6140
Exosome [BR:ela04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UCREL1_6140
  Exosomal proteins of breast cancer cells
   UCREL1_6140
  Exosomal proteins of colorectal cancer cells
   UCREL1_6140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Gtr1_RagA
Motif
Other DBs
NCBI-ProteinID: EMR66867
UniProt: M7SRJ5
LinkDB All DBs
Position
Unknown
AA seq 446 aa AA seqDB search
MSASLRTFAPFLRASRHSLRAGSNANPLQFAIRSQQNVGKAFNLARTYAVYERSKPHVNI
GTIGHVDHGKTTLSAAITKRQADKGMANYLEYGAIDKAPEERKRGITISTAHIEYSTDNR
HYSHVDCPGHADYIKNMITGAANMDGAIIVVAASDGQMPQTREHLLLARQVGVQKIVVFV
NKVDAIDDPEMLELVEMEMRELLSTYGFEGDETPVIMGSALMALEGKRDEIGVQKIDELL
AAVDSWIPTPERDLDKPFLMSVEDVFSIAGRGTVASGRVERGTLKRDSEVELVGKGGEVI
KTKVTDIETFKKSCEESRAGDNSGLLLRGIRREDVRRGMVICRPGSVKAHKKFMISLYVL
TKDEGGRHTGFQENYRPQMYLRTADEACALFFPDDAEDKTRMVMPGDNVEMVATLHNPLA
VEAGQRINVREGGRTVATGIVTRILE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgtcactaagaacgtttgcgccgttcttgcgcgcgtcccgtcattccctcaga
gccggcagcaacgccaaccccttacagtttgccataaggagccagcaaaatgtcggaaag
gccttcaacctcgctcgcacatatgcagtctacgagagatcaaagccccatgtgaacatt
ggtaccattggacacgtcgatcatggaaagactactttgtctgctgccatcaccaagaga
caggccgataaggggatggccaactacctcgagtacggcgccatcgacaaggcccccgag
gagcggaagcgtggtatcaccatctcgaccgcccacatcgagtattccaccgacaaccgc
cactactcccacgtcgactgtcccggtcacgccgattacatcaagaacatgatcacgggt
gccgccaacatggacggcgccatcatcgtcgtagccgcctccgacggccagatgccccag
acccgcgagcatctgctgctggcccgccaggtcggcgtccagaagatcgtcgtcttcgtc
aacaaggtcgacgccatcgacgaccccgagatgttggagctggtcgagatggagatgcgc
gagctgctcagcacgtacggcttcgagggcgacgagacgcccgtcatcatgggctcggcc
ctgatggccctcgagggcaagcgcgacgagatcggcgtgcagaagatcgacgagctcctc
gccgccgttgacagctggatccccacgcccgagcgcgacctcgacaagcccttcctcatg
tccgtggaggacgtcttctccatcgccggccgcggcaccgtcgcctcgggccgcgtggag
cggggcacgctcaagcgggactccgaggtcgagctcgtgggcaagggcggcgaggtcatc
aagaccaaggtgacggacatcgagaccttcaagaagtcgtgcgaggagtcgcgggccggc
gacaactcgggcctgctgctgcggggcatccggcgcgaggacgtgcgccgcggcatggtc
atctgcaggcccggttcggtcaaggcccacaagaagttcatgatctccctgtacgtgctg
accaaggacgagggcggccgccacaccggcttccaggagaactaccgcccccagatgtac
ctgcgcaccgccgacgaggcctgcgccctcttcttccccgacgacgccgaggacaagacc
cgcatggtcatgcccggcgataacgtcgagatggtcgccaccctgcacaacccgctcgcc
gtcgaggccggccagcgcatcaatgtccgcgagggtggccggaccgtcgctactggtatc
gttacccggatcttggaataa

DBGET integrated database retrieval system