KEGG   Eutypa lata: UCREL1_6309Help
Entry
UCREL1_6309       CDS       T03103                                 

Definition
(GenBank) putative alpha-glucosidase protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ela  Eutypa lata
Pathway
ela00052  Galactose metabolism
ela00500  Starch and sucrose metabolism
ela01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    UCREL1_6309
   00500 Starch and sucrose metabolism
    UCREL1_6309
Enzymes [BR:ela01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     UCREL1_6309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-ProteinID: EMR66699
UniProt: M7SK36
LinkDB All DBs
Position
Unknown
AA seq 661 aa AA seqDB search
MNININQTESGDQFLEYNTIGGVLDFYFLAGPSPADVNKQYAEVVGLPAMMAYWTFGFHQ
CKYGYWDVNYAAEVVGNYSTADIPLEVLWGDIDYMDLRQVFTTDPERFPVHKMRELVETL
HQRDQYYIMMLDPGIHRLGNYSTFVRGEENDVFLKANDGSLYRGVQWAGEVVWPDWLAPN
TQDWWTNEIALFFNPESGIDIDGAWNDMNEASNFCPNITCDPALVAELGNNPPQPTNPPR
NNTGRPIPGFPEDFQPGSSESLAKVRARQGSGGQMKGLPDRDLFSPDYRINNHRGELSDS
TIYTNITNADGTSQYDTHNLYGYTMLIASRNSLLARRPGKRPFVLTRSTFAGAGSKAAHW
FGDNNSTWSDYRVTIPQLLAFAAIHQMPMVGSDVCGFNGVADEKMCARWALLGAFQPFYR
NHADMSAPPQEFYLWELVTEAAKKAIDVRYRLLDYMYTALYRSSSTGAPIANPLFFLYPS
DANTFGVDTQYFYGDALLVYPVVDDYAESVTYYLPDDIFYDFWTLEPVRGEGANVTVDGV
GWTDIPVHIRGGTILPLRTESANTTALVRHKNFTIIVAPGLDGKAAGSLYLDDGESIDVG
DESIDINFDWDGTTFTATGTFGYETDVVVESVVVLGEDQRTQEGPWGLSEPFEFTLSSRY
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaacataaatcagaccgagtctggtgaccagttcttggaatataacaccatc
ggaggggttctggatttctactttttagccggccctagccctgcggacgtcaacaagcag
tacgcggaggtcgttggtcttcccgcaatgatggcctattggacattcggcttccaccag
tgcaagtacgggtactgggatgtgaactacgcagctgaagtcgttggtaactattccaca
gccgatataccattagaggtgctttggggagatatagactatatggaccttcgccaagtg
ttcaccactgaccccgagcgcttcccagtgcacaagatgcgtgagctagtagagacttta
caccagagggaccagtattacatcatgatgcttgaccctggtattcatagactcggaaac
tattcgacatttgtcagaggtgaggagaatgacgtcttcctgaaggccaatgatggatca
ctttatcgtggtgttcaatgggctggagaggtggtgtggccggattggcttgcacccaat
acccaagattggtggacgaatgagatagcattgttcttcaacccggagtccggcatcgac
atagatggagcatggaacgatatgaacgaagcgtccaacttctgtccaaatatcacttgt
gatcctgctctggtggcagaactaggtaacaaccctccccagccgaccaacccgcctagg
aacaacacgggcagaccgatcccaggatttcccgaagactttcaacctggctcatctgag
tctctcgcgaaagttcgggcgagacagggttccggtggacagatgaagggtcttccagac
cgtgacctcttctcccccgattaccgcatcaacaatcacagaggcgagctgagcgattct
acgatctacaccaacatcacgaatgcagacggcacttcccagtacgacacccacaacctc
tacggttacacgatgctcatcgccagccgcaactccctactagcccggcggcccggaaag
cgccccttcgtcctgacgcgatcgacgttcgcgggcgccgggtccaaggcggcgcactgg
ttcggcgacaacaactcgacgtggtccgactaccgggtgacgatcccacagctgctcgcc
ttcgccgccatacaccagatgccgatggtggggtccgacgtgtgtggtttcaacggagtg
gccgacgagaagatgtgcgcgcgatgggctctgctgggcgctttccaaccgttctaccgc
aaccacgccgacatgagcgcgccgccgcaggaattctacctctgggagctggtcacggag
gcggctaagaaggccatcgatgtgcgctacagactgctagattacatgtacacggcgctg
taccggtccagctcgacgggcgcgccgattgcgaatccgctgtttttcctctatccgtcg
gacgcgaacacgttcggcgtcgatacccagtatttctatggggacgcgctgctggtgtat
cctgtcgtcgacgattacgccgagtctgtgacgtactacctgcctgatgatatcttctac
gacttctggaccctggagccggttaggggtgagggggcgaacgtcacggttgatggggtg
ggctggaccgatataccggttcatatccgcggcggcacgatactgccactgcggactgaa
tctgctaatacgactgcgctggtgagacataagaacttcactattattgtggctccgggg
ttagatgggaaggcagcaggatcattgtatctggatgatggagagagcatcgatgtggga
gatgagagcatagatattaacttcgattgggatggaacaacgtttacagccactgggacg
tttgggtacgagactgacgttgtggtggagagtgtggtcgttctgggtgaagatcagaga
actcaagaaggtccatggggcctaagcgagccgttcgagttcactttgagctctcgatat
ggctag

DBGET integrated database retrieval system