KEGG   Eutypa lata: UCREL1_633Help
Entry
UCREL1_633        CDS       T03103                                 

Definition
(GenBank) putative glutamate decarboxylase protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ela  Eutypa lata
Pathway
ela00410  beta-Alanine metabolism
ela00430  Taurine and hypotaurine metabolism
ela00650  Butanoate metabolism
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
Module
ela_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UCREL1_633
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UCREL1_633
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UCREL1_633
   00430 Taurine and hypotaurine metabolism
    UCREL1_633
Enzymes [BR:ela01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UCREL1_633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: EMR72317
UniProt: M7T6Q3
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MVHLAAIPQDSEANKLPEAVSKVSLQLSEEEDSFTTSIYGSRFAAEDLPRLEIPDGEMPK
EIAYKLIKDELSLDGNPMLNLASFVTTYMEEEAEKLMTDSFSKNFIDYEEYPVSADIQNR
CVSMIGRLFNAPVDDSGSSAPVGTSTIGSSEAIMLGVLAMKRRWKNKRKAEGKSTENPNI
VMSSAVQVCWEKATRYFEIEEKLVYCTPDRFVIDPVETVNLIDENTIGICAILGTTYTGE
YEDVKAVNDLLVERGIDCPIHVDAASGGFVAPFVVPDLEWDFRCEKVVSINVSGHKYGLV
YPGVGWVVWRAAEFLPQELVFNINYLGADQASFTLNFSKGASQVIGQYYQLIRLGKKGYK
AIMSNLTRTGNYLSESLEALGFIIMSKQSGMGLPLVAFRLPPKEEREWDEFSLAHRLRAR
GWVVPAYTMAPHTNEMKMLRVVVREDFSKNRCDSLICDIKLCMELLDAMDKETIKKHEQF
IRTHAMHSGQSKHNHPKFRNEKHSLQGKHGKTHGVC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggtccatcttgctgccattccccaagatagcgaggctaacaagctccctgaggctgtc
agcaaggtcagcttgcagctcagtgaggaggaggattccttcaccaccagcatctatggg
tctcggttcgcggccgaggatcttcctcggcttgagattcccgacggcgaaatgcctaag
gagatcgcctataagctgataaaggacgagctcagcttggacggaaacccgatgctcaac
cttgcgtcttttgtcactacctacatggaagaggaagcggaaaagctcatgactgattcg
ttctcgaagaacttcattgattatgaggagtatcccgtgtctgctgatatccagaaccga
tgtgtctctatgatcggtcgcctctttaatgcgccagtcgatgacagcggtagcagcgcg
cctgttggaacctcgaccataggcagctcggaagcgatcatgcttggtgttctggctatg
aagaggcgttggaagaataagagaaaggctgagggcaagtcgacggagaatcctaacatc
gtcatgtcatcggctgtacaggtttgttgggagaaggccaccagatatttcgagatcgag
gagaagctggtctattgtacccctgaccgattcgtcatcgaccccgtagagacggttaac
ctcatcgatgagaataccatcggcatctgtgctatccttggaactacatatactggagag
tatgaggatgttaaggcagtcaatgatctccttgtggagagaggtattgactgtccgatt
cacgtggacgctgccagcggcggctttgttgctccgtttgtcgtacccgatttagaatgg
gacttccgttgcgagaaggtggtatctatcaatgtgtctgggcacaagtatggtttggtc
taccctggcgtcggttgggtcgtctggagagcagccgagttcctaccccaggagcttgtg
ttcaacatcaactacctcggggcagaccaagcgtccttcaccctaaacttttcgaagggt
gccagccaagtcattggtcaatactaccaacttattcgacttggaaagaagggctataaa
gcaatcatgtcgaatctaacccgcacgggcaactacctctccgagtccctggaagcattg
ggctttatcatcatgagcaagcagtccggtatggggctgcctctagtagcattccggctc
ccacctaaggaagagcgagaatgggatgagttctcgcttgcccacaggctacgcgcccga
ggatgggttgtcccggcttatacgatggcaccgcacacgaatgaaatgaagatgctgcgt
gtggtcgtccgagaggatttcagcaagaaccgttgcgattcgttgatctgtgatatcaag
ctttgtatggaactgcttgacgccatggacaaggaaaccatcaagaagcacgaacagttc
atccgcacgcatgcgatgcacagcggacagtcgaagcacaaccacccgaagttcaggaac
gagaagcattcactccaaggcaaacatggaaagacgcatggagtctgctag

DBGET integrated database retrieval system