KEGG   Eutypa lata: UCREL1_6838Help
Entry
UCREL1_6838       CDS       T03103                                 

Definition
(GenBank) putative histone deacetylase hos3 protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
ela  Eutypa lata
Brite
KEGG Orthology (KO) [BR:ela00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ela03036]
    UCREL1_6838
Enzymes [BR:ela01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     UCREL1_6838
Chromosome and associated proteins [BR:ela03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     UCREL1_6838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-ProteinID: EMR66179
UniProt: M7SIN2
LinkDB All DBs
Position
Unknown
AA seq 614 aa AA seqDB search
MHGVLAHGLTHAAIIDFDLHHGDGSQAITWAHNKRGLPKNVASWKKTPIGYFSLHDINSY
PCEWGDEEKVKNASLCIDNAHGQNIWNVHLQEWKTEVDFWRLYQSRYSVLLEKARNFLRL
QTERLRAAGQVPKAAIFLSAGFDASEWEGVGMQRHKVNVPTEFYARITRDVVKMASEEGL
GVEGRIISVLEGGYSDRALYSGASEAKLTEIAKIRRSVSGVGVPSGGHNYNIPRVPTPPP
PDVPWTAAAHELSKLLVPNDRQINSCKHEELNTEATKAKQKRQSLNSAVKSENGDAEPAI
PSRPSTRMSLRERKPTNYTDPDSDIDKARRKTVGGALATEKANARGKLPSQNETKLLQQP
RSTSGATSKASSDNGGDLDNITNGMKRIKINVLTKEKKEARQREAAEKKAASERATSEEA
VSASPFEEVPIPTIMTPTIESNNHQPHSTGNSPEAAAATAQTPDPFVPYHPDGPPAAAIP
LSGPVRILDPNTGTPASARPHSPRKQQQRSPSKAAIAATAQQQNKHQPPPPPPQPPLPFD
ARVLALSPDRKGYHGFTATSPIPFAAPRPTVAALEPDRNQNATTTTTATEGSSPSGGRGK
VWDVPETPGLRRQV
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgcacggagtcctggcgcatggtttgacgcacgctgctattatcgactttgaccttcac
catggtgatggatcccaggctatcacgtgggcgcacaataagcgtgggctgcccaagaat
gttgcctcgtggaagaagaccccgatcgggtactttagccttcacgatattaactcatac
ccgtgcgaatggggtgacgaggaaaaggtcaagaatgctagtctttgcattgataatgcc
catggacagaacatatggaatgtccatttacaagagtggaaaacggaggtcgacttctgg
cgactataccaatccaggtattctgttttactcgagaaagctcggaacttcctccgattg
cagactgaacggctccgggctgcgggtcaggtgcccaaggctgcgatattcttatctgcc
ggtttcgacgcaagtgaatgggaaggcgttggcatgcagcgacacaaggtcaacgtgccc
accgagttctacgcccggattactcgtgatgttgttaagatggcatcagaggaaggtctg
ggcgtggagggacgcattattagtgtactcgaaggtggttatagcgaccgagccctgtat
tcaggggcttctgaagccaagttgaccgagatagctaaaatccgtcgaagcgtatcgggg
gtcggtgttcccagtggtggacacaattataatatcccgagagtgccgactcctccacct
cctgacgtaccatggacggcggctgctcatgagctgagcaaactactggtccccaatgac
cgccagattaacagctgtaaacatgaagagctcaatacagaggcaaccaaagccaagcag
aagcgtcagtccctaaacagtgctgtcaagagcgagaatggggatgctgagcctgctatt
ccttctcgtccttcgacgcgaatgtctctacgtgaacgcaagcctaccaactacactgac
cctgacagcgatattgataaggcacgtagaaagacagtcggcggtgcactcgctacggag
aaggccaatgctcgtgggaagcttccgtcacaaaatgaaaccaagcttcttcagcaacca
aggtctacatccggtgctacatctaaggcttcttctgacaatggaggcgacttggataat
attaccaatggaatgaaacgtatcaagattaatgttctaaccaaggagaagaaggaggca
agacagcgagaagcagctgagaagaaggccgcgtcagaaagagcaacatctgaggaggct
gtttcggcctcaccattcgaagaagtcccgatccccaccatcatgacgccaaccatcgaa
agcaacaaccaccaaccacattcgacgggcaactctcccgaggcggcggcggccaccgcg
cagaccccagaccccttcgtgccgtaccaccccgacggcccgccagcagcagccatcccc
ctctcaggtccggtccgcatcctagatcccaacacgggaaccccggcttcggctcgtccg
cattcgcctcgcaagcaacagcagcgctcgcctagcaaggcagcaatagcagcaacagcc
caacagcaaaataagcatcagccaccaccaccaccaccacaaccacctctcccgttcgac
gcgcgcgtgctcgccttgagcccagataggaaggggtatcacggcttcactgccacgtct
ccgatcccgttcgcggcgccgcgacctactgttgctgctctggagccggaccggaaccag
aatgctaccactactactacggctacggaaggaagcagcccgagcggcggcaggggaaag
gtttgggatgtccctgagacgcctggactgaggcgccaggtttag

DBGET integrated database retrieval system