KEGG   Eutypa lata: UCREL1_6930Help
Entry
UCREL1_6930       CDS       T03103                                 

Definition
(GenBank) putative succinate dehydrogenase flavoprotein mitochondrial precursor protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ela  Eutypa lata
Pathway
ela00020  Citrate cycle (TCA cycle)
ela00190  Oxidative phosphorylation
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
ela01130  Biosynthesis of antibiotics
ela01200  Carbon metabolism
Module
ela_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ela_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ela_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCREL1_6930
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UCREL1_6930
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UCREL1_6930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: EMR66085
UniProt: M7TH90
LinkDB All DBs
Position
Unknown
AA seq 637 aa AA seqDB search
MKNGVLNGNEEVSHWLFLLTPNSIEMSSQDFLFYTSRLYVTPHIEYIDHEYDAIVVGAGG
SGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHKDDWRWHMYDTVKGSD
WLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSKEFGKGGQAYRCCA
AADRTGHALLHTLYGQSLRHSTNYFIEFFALDLIMEDGECRGVLAYNMEDGTLHRFLAQN
TVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGS
RGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIYLQLSHL
PAEVLAERLPGISETAAIFSGVDVRKQPIPVLPTVHYNMGGIPTRYTGEVLTVDDAGNDK
VVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDNFTPGAKPNPISADAGA
ESIEVLDEVRNSSGPLTTAEIRLSMQKAMQTDVSVFRTQESLDEGVKKVKEIDATFPQVG
IKDRTMIWNTDLVETLELRNLLTCATQTAHAAANRKESRGAHAREDFPERDDVNWMKHTL
TFQKKPHTGVDLGYRRVIGTTLDENECKAVPPFKRTY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatggcgtcctcaatggcaatgaggaggttagccactggctcttccttctcacg
cctaacagcatcgagatgtcaagccaggactttctcttctacacgtcccgtctgtacgtc
actccccacatcgagtacattgaccatgagtacgatgcgattgttgtcggcgccggtggt
tccggcttgcgtgcggcctttggtctagccgaagctggcttcaacaccgcctgtatatcc
aagctcttcccgacgagaagtcatacggtcgccgctcagggtggtatcaacgccgcctta
gggaacatgcacaaggacgactggagatggcacatgtacgatacagttaaggggtccgat
tggcttggagaccaagatgctattcactacatgacaagagaagcgcccgcatccattatt
gagctcgagaactatggctgtccattctcaagaaccgaggatggcaagatctaccaacgt
gcttttggtggtcaatccaaggagttcggaaagggtggtcaggcctaccgatgctgcgct
gctgccgaccgaactggccacgctctcctacacaccctgtacggccagtctctgcgacac
agcaccaactacttcatcgagttctttgcgcttgacctgattatggaggacggagaatgc
cgaggtgttctcgcctacaacatggaagatggcacgctacaccgattccttgcgcagaac
actgtcttagccactggtggatacggacgcgcttatttcagttgcacatccgcccacacg
tgcactggtgatggtatggctatggtcgctcgtgctggtctccccaaccaggatctcgaa
ttcgttcagttccaccccactggtatctacggagctggttgcttgattacggagggctcg
cgtggtgagggtggttatctcctcaactccgagggtgagcgatttatggagcgatatgcc
cccacagccaaggatctggccagtcgtgacgttgtctcgcggtccatgaccctggaaatt
cgggagggccgcggtgtcggccctgagaaggaccacatctacctccaactgagccacctt
cccgctgaagttcttgctgagcgtttgcctggtatttccgagacggccgccattttctcc
ggtgttgatgtccgcaagcagccaattcccgtcctaccgactgtccactacaacatgggt
ggtatccccacgagatacactggtgaggtccttacggtggatgatgctggtaacgacaag
gtcgtccccggtctgttcgcttgtggtgaggctgcttgcgtgtccgtccatggcgccaac
cggttaggtgccaactctctgctggatcttgtcgtgtttggccgtgccgtttcgcacact
atccgggataacttcacccccggggctaagcctaatcccatcagcgcagatgctggtgcc
gaatcgatcgaggttctcgatgaggtccggaactctagcggccccctgaccacggccgaa
atcagactctctatgcagaaggccatgcagacagacgtcagcgtcttccgcacgcaggag
agtctggatgagggtgtgaagaaggtgaaggaaattgatgctacgttccctcaagtcggt
atcaaggatcgcaccatgatctggaacacagacctagtggagactcttgagttaaggaat
ctgctcacttgcgcaacacaaactgctcacgcagctgccaacagaaaggagtcacgtgga
gcccatgcccgggaagacttccccgagagagacgatgtgaactggatgaagcacaccttg
acgttccagaagaagcctcatacaggggttgatctcggttacagacgtgttatcggcacg
accctagacgagaacgaatgcaaggccgtcccgccattcaagcgaacttactag

DBGET integrated database retrieval system