KEGG   Eutypa lata: UCREL1_7517Help
Entry
UCREL1_7517       CDS       T03103                                 

Definition
(GenBank) putative xylitol dehydrogenase protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
ela  Eutypa lata
Pathway
ela00040  Pentose and glucuronate interconversions
ela01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UCREL1_7517
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     UCREL1_7517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Pyr_redox_2 PALP 2-Hacid_dh_C UDPG_MGDP_dh_N HI0933_like AdoHcyase_NAD Pyr_redox_3 Pyr_redox Met_10
Motif
Other DBs
NCBI-ProteinID: EMR65507
UniProt: M7SMR9
LinkDB All DBs
Position
Unknown
AA seq 358 aa AA seqDB search
MDPKSASNLSFILNKPNDVTFADRPVPQLPDEHSVLVAVNYTGICGSDVHYWVHGAIGHY
VVKEPMVLGHESAGTVVSVGSAVKTLKAGDRIALEPGYPCRRCGPCLSGKYNLCPEMRFA
ATPPYDGTLTGFWAAPADFCYKLPDAVSLQEGALIEPLAVAVHIVRQAAVAPGQTVVVMG
AGPVGLLCAAVAKAFGASIVVSVDIVQSKLDFAKSFCSTHTYASQRISAEENAANIRREA
GLPEGADAVIDASGAEPSIQTSLHTVRNGGVYVQGGMGKSDITFPIMALCLKEVTAKGSF
RYGSGDYRLAVSLVATGKVDVKRLISGVVPFKEAEDAFKKVKEGEVIKMLIAGPNEKI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggaccccaaatcagcaagcaacctctccttcatcctcaacaagcccaatgacgtcacg
ttcgccgacaggccggtgccccagctccccgacgagcacagcgtgctcgtggccgtgaac
tacaccggcatctgcgggtcggatgtgcactactgggtgcacggggcgatcgggcactac
gtggtgaaggagccgatggtgctgggccacgagtcggcggggacggtggtgtcggtcggg
tcggcggtcaagaccctcaaggccggcgaccgcatcgcgctcgagccgggctacccgtgc
cgccgctgcggcccctgcctcagcggcaagtacaacctctgcccggagatgcggttcgcg
gcgacgccgccctacgacgggacgctgacggggttctgggccgcccccgccgacttctgc
tacaagctccccgacgccgtctccctgcaggagggcgcgctgatcgagcccctcgccgtc
gccgtccacatcgtgcgccaggccgccgtcgcgccgggccagaccgtcgtcgtcatgggc
gccgggcccgtgggcttgctctgcgccgctgtggcgaaggcgttcggcgcgtctatcgtc
gtatcggtcgacatcgtgcagtcgaagctcgacttcgcgaagtccttctgctccacccac
acgtacgcgagccagcggatctccgccgaggagaacgccgctaacatccggcgggaggcg
gggctgcccgagggcgccgatgccgtcatcgacgcgagcggcgccgagcctagcatccag
actagtctgcacacggtgcgcaatggcggcgtgtacgtgcagggcggcatggggaagtcg
gatatcacgtttcctattatggcgctctgcctcaaggaggtcacggctaagggtagcttc
cgttatggcagtggtgactacaggcttgcggtctctcttgtcgccaccggcaaggtcgac
gtcaagcgcctcattagcggcgtcgtgccctttaaggaggccgaggatgccttcaagaag
gttaaggagggtgaggtcatcaagatgctcattgctgggcctaacgagaagatttag

DBGET integrated database retrieval system