KEGG   Eutypa lata: UCREL1_8502Help
Entry
UCREL1_8502       CDS       T03103                                 

Definition
(GenBank) putative isocitrate dehydrogenase protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ela  Eutypa lata
Pathway
ela00020  Citrate cycle (TCA cycle)
ela00480  Glutathione metabolism
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
ela01130  Biosynthesis of antibiotics
ela01200  Carbon metabolism
ela01210  2-Oxocarboxylic acid metabolism
ela01230  Biosynthesis of amino acids
ela04146  Peroxisome
Module
ela_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ela_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCREL1_8502
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    UCREL1_8502
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    UCREL1_8502
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     UCREL1_8502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: EMR64532
UniProt: M7SK25
LinkDB All DBs
Position
Unknown
AA seq 455 aa AA seqDB search
MRYVRPSAFARSARPIFRTAAPPSAKNSSIAIPVALFHHSRANMLQQKIKVKNPVVELDG
DEMTRVIWKDIKDKFIFPYLDIDLKYYDLGLEYRDETSDKVTLDAAEAIKKYSVGIKCAT
ITPDEARVKEFNLKQMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPGWKKPIIIGRHAF
GDQYRAKDAVLPGPGKLSMVYTPEGGEPQEIEVYQFKSGGGVAQTQYNTDESITGFAHAS
FKLALDKGLPLYMSTKNTILKKYDGRFKDIFQEIYDSQYQKAFEEKGIWYEHRLIDDMVA
QMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHY
REHQKGRETSTNPIASIFAWTRGLIQRGKLDGQPELVAFAEGLEKACVDTVDVDGVMTKD
LALACGKSDRADYVTTSEYLAAVEKRLKNALKEKL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacgtccgaccgtctgccttcgccagatcggcacgaccaatctttcgaaccgcc
gccccaccgagcgcgaagaacagcagcatagcgataccggtggccctgttccaccacagc
agagcgaacatgctgcagcagaagatcaaggtcaagaaccccgtcgtcgagctcgacggt
gacgagatgacccgcgtcatctggaaggacatcaaggacaagttcatcttcccctacctg
gacatcgacctcaagtactacgacctcggcctcgagtaccgcgacgagaccagcgacaag
gtcaccctcgatgccgccgaggccatcaagaaatactccgtcggcatcaagtgcgccacc
atcacccctgatgaggcgcgtgtcaaggagttcaacctgaagcagatgtggctgtccccc
aacggcacaatccgcaacgccctaggcggcacggtattccgggagccgattgtgatcccg
cggatcccgcggctggtgccgggctggaagaagcccatcatcatcgggcggcacgccttc
ggcgaccagtaccgggcgaaggacgccgtgcttcccggccccgggaagctgtcgatggtg
tacacgcccgagggcggcgagccccaggagatcgaggtctaccagttcaagagcggcggc
ggcgtcgcgcagacccagtacaacaccgacgagagcatcacgggcttcgcgcacgccagc
ttcaagctcgccctcgacaagggcctgccgctgtacatgagcaccaagaacaccatcctc
aagaagtacgacggccgcttcaaggacatcttccaggagatctacgattcgcagtaccag
aaggccttcgaggaaaagggcatctggtacgagcaccgcctcatcgacgacatggtcgcc
cagatgatcaagagctcgggtggctacatcatggcgctgaagaactacgacggcgacgtg
caatccgacatcgtagcgcagggcttcgggtccctgggcctgatgacgtcggtgctgatc
acgccggacggcaagacgttcgagtcggaggcggcgcacgggacggtgacgcggcactac
cgggagcaccagaaggggcgggagacgagcacgaacccgatcgcgagcatcttcgcgtgg
acgcggggcctgatccagcggggcaagctcgacgggcagcccgagctcgtcgccttcgcc
gaggggctcgagaaggcctgcgtcgacaccgtcgacgtcgacggcgtcatgaccaaggac
ctcgcgctggcgtgcggcaagtccgaccgcgccgactacgtcaccacgtccgagtacctg
gccgcggtcgagaagaggctgaagaatgcgctgaaggagaagttgtaa

DBGET integrated database retrieval system