KEGG   Eutypa lata: UCREL1_8778Help
Entry
UCREL1_8778       CDS       T03103                                 

Definition
(GenBank) putative phosphopantothenate-cysteine ligase protein
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
ela  Eutypa lata
Pathway
ela00770  Pantothenate and CoA biosynthesis
ela01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    UCREL1_8778
Enzymes [BR:ela01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     UCREL1_8778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP CCDC53 Spt20 DUF4834 SpoIIP
Motif
Other DBs
NCBI-ProteinID: EMR64255
UniProt: M7TC69
LinkDB All DBs
Position
Unknown
AA seq 444 aa AA seqDB search
MASQATTGTSASGSSYLMDENAYFSSNPPPKALPQHTAAAEAFIRQHAASGRRVVLITSG
GTTVPLEKNTVRFIDNFSAGTRGATSAEYFLEAGYAVIFLHRQFSLLPYSRHYSHSTDCF
LDFLHEAPEGNVVANPAHQAKMLRVLRKYSAAKSQNTLLMLPFVTITDYLHELRAVAQLM
RPLGPDGLLYLAAAVSDFFVPPDRMAEHKIQSTDATDALKQKKQQEQQQQQQQQQQPPPR
QQGPTTITQEQRSNNNGEEEAFDNFDSSPAVPRSKRLIIDLDPVPKFLKNLVDGWAPEGM
IVSFKLETDPAILVHKASYSLDRYQHHLVVGNLLTTRKWEVVFVAPGERDRWIRVPSARR
KRTQTGVEEMVGAAEREKGEELELEKEKEKKKKKSLVEGEDKPMDPASLPEGEPEIEIES
LIIPAVQGLHDKHIQSVAARNKSS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctagccaggcaaccaccgggacatctgcatcgggttcttcctacctgatggacgag
aacgcctacttcagctcgaacccgcccccgaaggcgctaccgcagcacaccgccgcggca
gaggccttcatccgccagcacgcggcctcggggcggcgcgtcgtgctcatcacgtcgggc
gggaccaccgtcccgctcgagaagaacaccgtgcggttcatcgacaacttcagcgcgggg
acgcgaggagccacatccgccgagtacttcctggaggcgggctacgccgtcatcttcctg
caccgccagttcagcctgctgccctacagccgccactacagccacagcaccgactgcttc
ctggacttcctgcacgaggcgcccgagggcaacgtcgtcgcgaacccggcccaccaggcc
aagatgctccgcgtcttgcgcaagtacagcgccgccaagagccagaacacgctgctcatg
ctgcccttcgtgaccatcacggattacttgcacgagctgcgcgcggtggcccagctcatg
cgccccctgggccccgacggcttgctctacctcgctgctgccgtcagcgacttcttcgtg
ccgccggatcgcatggccgagcacaagatccagagcacggacgcgaccgatgccctcaag
caaaagaaacaacaggagcagcagcagcagcagcaacagcagcagcaaccgccgccccgg
cagcaaggtccgacgacaatcacgcaggagcagcgcagcaacaacaacggcgaggaggag
gcgttcgacaacttcgactcgtcgccggcggtgccgcggagcaagcggctgatcatcgac
ctggacccggtgcccaagttcctcaagaacctggtggacgggtgggcgcccgagggcatg
atcgtgtcgttcaagctggagacggacccggcgatcctggtgcacaaggcgagctactcg
ctcgaccggtaccagcaccacctggtcgtcggcaacctgctgacgacgcgcaagtgggag
gtcgtcttcgtggccccgggcgagcgcgaccgctggatccgcgtcccgagcgcccggcgg
aagaggacccagacgggggtcgaggagatggtcggggctgcggagcgggagaagggagag
gaactggaactggaaaaggaaaaggaaaagaagaagaagaaaagcttggtggagggcgag
gataagcctatggatccggcgagcctacccgagggcgagccggagatcgagatcgagagc
ttgataataccagctgtccaggggctgcacgataagcacatccagtctgtcgctgcgcgg
aataaatcaagctag

DBGET integrated database retrieval system