KEGG   Eutypa lata: UCREL1_930Help
Entry
UCREL1_930        CDS       T03103                                 

Definition
(GenBank) putative oxoglutarate dehydrogenase protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ela  Eutypa lata
Pathway
ela00020  Citrate cycle (TCA cycle)
ela00310  Lysine degradation
ela00380  Tryptophan metabolism
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
ela01130  Biosynthesis of antibiotics
ela01200  Carbon metabolism
Module
ela_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ela_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCREL1_930
  09105 Amino acid metabolism
   00310 Lysine degradation
    UCREL1_930
   00380 Tryptophan metabolism
    UCREL1_930
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     UCREL1_930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N baeRF_family12
Motif
Other DBs
NCBI-ProteinID: EMR72012
UniProt: M7T5V2
LinkDB All DBs
Position
Unknown
AA seq 1039 aa AA seqDB search
MLRSSLRNSGSKLLRAGCHPSRCPSQSTRCFSVSSTRRPLALSSQKRLASTTSIPPSPND
NFLSGSTANYIDEMYMQWREDPESVHVSWQVYFKNMESGEMPIQQAFTPPPTLIPGAAGG
VGPAIGVGVAGSSDVMNHLKVQLLVRAYQARGHHKAKIDPLGIRTETDFTTVKPKELTLE
HYQFTEKDLDSEITLGPGILPRFKREGREKMPLRDIIAACEQIYCGSYGVEFIHIPDRTK
CDWLRERVEVPVPFKYSIDEKRRILDRLIWSSSFESFLATKYPNDKRFGLEGCETLVPGM
KALIDRSVDFGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTAGAEDEGSGDVKYH
LGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKTHRSAMSVLLHG
DAAFAAQGIVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAYCTDIAKAIDA
PVFHVNADDVEAVNFVCQLAADWRAEFQSDVVIDLVCYRKYGHNETDQPSFTQPLMYKRI
NEHNPQIDIYVEKLLEDGTFTKEDVEEHRQWVWGMLEDSFSKSKDYQPTSKEWTTSAWNG
FKSPKELASEVLPHNPTNVEKQTLEHIAEVIGSAPEDFHLHRNLKRILANRSKTVLEGKN
IDWSTAEALAFGSLVAEGHHVRVSGQDVERGTFSQRHSVFHDQETENTYTPLQHISKDQA
KFVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQFIASGEVKWMQ
RTGLVMSLPHGYDGQGPEHSSGRIERYLQLSNEDPRVFPPEDRLERQHQDCNMQVVYMTT
PANLFHVLRRQMHRQFRKPLIIFFSKSLLRHPLARSNIEELTGPDAGFQWIIPDTEHATG
SIKGPEEIDRVILCSGQVYAALHKYRVDNKIDNVAITRIEQLNPFPWKQLKENLDTYQNA
KTVVWCQEEPLNAGAWSFTQPRIETLLNHTEHHDRKHVIYAGRNPSASVATGLKSTHKKE
EEDLLEAAFTVKQDKLKGE
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaagttcgcttcgaaattctggcagcaagctccttagagctggctgccaccca
tcgagatgtccgtcacaatctacgagatgcttctctgtgagctcgactcgccgtcctctc
gccctgtcctcccaaaagcgcctcgcctcgaccacttcgatcccaccctctcccaacgac
aacttcctctctggcagcactgccaattacattgatgagatgtacatgcagtggagggag
gatccagagagcgttcatgtgtcatggcaggtctatttcaagaatatggagtcgggtgag
atgcccattcagcaggctttcaccccacctcccaccctcatccccggtgcggcgggtggt
gttggacctgctattggagtaggtgtagcgggtagctctgatgtcatgaaccatctcaag
gttcagcttcttgtgcgcgcatatcaggctcgtggccatcacaaggccaagattgaccct
ctcggtattcgtaccgaaacggatttcactacggtcaagcctaaagaacttactcttgag
cactatcaattcaccgaaaaggacctcgattccgagattaccctgggtccgggtatccta
ccacgtttcaagcgcgagggtcgagagaagatgcctctccgtgatatcattgccgcctgc
gaacaaatctactgcggttcttatggcgtcgaattcattcatatccctgacaggaccaag
tgcgactggctgagagaaagggtcgaagtccctgtgcctttcaagtattccatcgatgag
aagcgccgaattcttgatcgcttaatctggagttcaagctttgaatccttcctggccacg
aaatatcctaacgacaagcgctttggtttggagggttgcgaaaccctcgtacctggaatg
aaggcccttattgatcgtagcgtcgacttcggcgtaaaagatattgtgattggaatgccg
catcgtggtcgtctcaatgtgctcagcaacgtcgtccgcaaaccgaacgagtccattttc
agcgagttcgccggtactgctggcgcagaagacgaggggtcgggtgatgtcaagtatcat
ttgggtatgaacttcgagcgtccgacaccttccggcaagcgagtccagctttcgctagtc
gccaacccttcgcatcttgaggccgaggacccggttgttcttggcaagactagggctatc
cagcattacaataatgatgagaagactcaccgtagtgccatgagcgttctcttacacggt
gatgctgcttttgctgcccaaggtatcgtctacgaatgtctcggtttccactcacttccg
gccttctctaccggaggaactatccaccttgttgtgaacaaccagatcggtttcactacc
gacccccgtttcgcccgctcgaccgcgtactgtaccgatatcgcgaaagccattgatgcg
cctgtgttccacgtcaacgcagacgatgttgaagctgttaatttcgtctgccagctcgct
gcggattggcgtgccgaattccagtccgatgtcgtcatcgaccttgtctgctaccggaag
tacggccacaatgagacggatcagccatctttcactcagcccctgatgtacaagcgcatt
aacgaacataacccgcaaatcgatatctacgtagagaagctgctcgaggatggtaccttc
acaaaggaggatgttgaggaacataggcaatgggtctggggcatgctggaagacagcttc
tccaagtccaaggattatcagcctactagcaaggaatggaccacttcggcttggaacggc
ttcaagtctcccaaggagttggcgtcggaagtcctaccgcataacccaactaacgtagag
aagcagacgcttgagcatatcgctgaggtcatcggctctgcaccagaagacttccatctt
caccgaaacctgaagcgtatcctcgctaaccgctccaagactgtcctggagggaaagaac
attgattggtcgaccgctgaggctcttgccttcggttcgctcgtcgctgagggtcaccac
gtgcgtgtctctggtcaggatgttgagagaggtaccttctctcaacgccattccgtcttc
cacgaccaggaaaccgagaatacctacacgccattacaacacataagcaaggaccaggcc
aagtttgtcatctctaactcttcgctgagtgagttcggcgctcttggcttcgagtacggc
tactcactttcttcgcccaacgctctcgtcatgtgggaggcccaatttggtgacttcgcc
aacaatgctcaatgcattattgatcagttcattgcttctggtgaagtcaagtggatgcag
cgaactggcctagtcatgtctctaccccatggatatgatggacagggtcctgagcactct
tctggtcgcatagaacgatacctccagctttccaatgaggatcctcgtgtcttcccgcct
gaggacaggcttgagcgtcagcatcaagactgtaacatgcaggttgtctacatgaccacc
cctgccaacttgttccacgtcctccgtcggcagatgcacagacagttcagaaagcctctc
ataatattcttctccaagtcgctcctgcgtcaccctctcgctcgatccaatatcgaggag
ttgaccggtcccgatgctggattccaatggatcatccctgatactgaacacgcgacgggc
agcatcaagggccccgaggagattgaccgtgtcattctgtgctccggtcaggtctacgcc
gcactacacaaataccgtgtcgacaacaagatcgacaacgttgccatcacacgtatcgag
cagctgaaccccttcccatggaagcaactcaaggagaacctggacacatatcagaacgcc
aagaccgtcgtatggtgtcaagaggagcctctcaacgcgggtgcctggagtttcacccag
ccgcgcatcgagaccctgctgaaccacaccgagcaccacgaccgcaagcacgtcatatac
gccggtcgtaacccgtcggcctcggtggctactggcctcaagtccacgcacaagaaggag
gaggaagacctgctagaggcggcgttcacggtgaagcaggataagctgaagggcgagtaa

DBGET integrated database retrieval system