KEGG   Elizabethkingia miricola: VO54_00728Help
Entry
VO54_00728        CDS       T03757                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
elb  Elizabethkingia miricola
Pathway
elb00620  Pyruvate metabolism
elb00680  Methane metabolism
elb01100  Metabolic pathways
elb01120  Microbial metabolism in diverse environments
elb01200  Carbon metabolism
Module
elb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:elb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VO54_00728 (ppc)
  Energy metabolism
   00680 Methane metabolism
    VO54_00728 (ppc)
Enzymes [BR:elb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VO54_00728 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4070
Motif
Other DBs
NCBI-ProteinID: AJW62214
UniProt: A0A0D5BJU4
LinkDB All DBs
Position
complement(775273..777810)
Genome map
AA seq 845 aa AA seqDB search
MKTNEQVEKFRQIVKNKFQIYNSLFMSLPYDKMTNIGMLLPFLHEESKEGYENGKSPMEV
MKHFFDSHTDLKTEEERIDLLFRIIQYVERQVVLFDSIEDSAFSTLNANTDPGTVRNLYE
VASQQGKLQIIKEKMEQFGVKVVFTAHPTQFYSNSVQSILHDLNQAIKSDSVTNIDMLLQ
QLGMTSFINQEKPTPYDEAQSIIYYLRYVYYDTLGELYRDTKRIFDDADINPHLFQLGFW
PGGDRDGNPFVTAEITQRVSSELRLAILKCYYEHLKKLRKRITFPKVTEMLRQISERVYQ
NIFENKYDLTAGEFKIALQDIRHEVKENNNGLFIDKIDDLIGRIDLFGIYFASLDIRQNS
KIHYKALEQIFEKEFGKDYHALNEDEKLNLLLNTSLQVDPENYSDDIVKDTLKNIYQVKD
IQELNGEQSIHRYIISDSSSIYDVLNVYALFKYCGYADKDIKIDIVPLFETIEGFENAEA
TMNRLYNLAQYKEHLNRRNGRQFIMLGFSDGTKDAGYIKANWDIYTTKEVLSKVSDENDI
KVIFFDGRGGPPARGGGKTHQFYAAQGKSIANHQIELTIQGQTITSVFGTKDQATFNFEQ
LLTAGLENEIFPQDKINLKDWERALLNELAGISYQKYKALKDHPLFVPYLEEVSTLKYYG
RTNIGSRPSKRNDGQLVFEDLRAIPFVGSWSLLKQNVPGYFGVGTALQRLKEEGRLEDLK
KLYRESMFFKTLIQNSMMSMSKTYFPLTYYLRNDKVFGEFWQILHNEYLLTHEMLLEIAN
YKSLMEEEPLSKSSIKMRENIVLPLLTIQQYALQKIKEENPHKETYEKIVTRALFGNINA
SRNSA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccaatgaacaagtagaaaaattcagacaaattgtaaaaaacaaatttcagatc
tataatagccttttcatgagccttccatacgataaaatgaccaatatcggaatgctctta
ccttttctccatgaagagagtaaagaaggctacgaaaatggaaaatctccgatggaggtg
atgaaacatttcttcgacagtcatacagacctgaaaacagaagaggaacgaatagatctt
ttgttccgtattatccagtatgtagaaagacaggtagtattattcgatagtattgaagat
tcggcattttctacactaaatgctaatactgatcccggaactgtccgtaatttgtatgaa
gttgcatcccaacagggaaaactgcaaattattaaagagaaaatggaacaatttggtgtt
aaagttgtgtttacagcacacccaacacaattttattccaattccgtacaatccattctc
catgatctgaatcaggctataaaatccgattcagttaccaatatcgatatgctcctgcag
cagttgggaatgacgtcatttatcaatcaggaaaagccaacaccttatgacgaggctcag
agtattatctattatctgcgctatgtttattatgatactctgggagagttgtaccgggat
accaaacgtatttttgatgatgctgatataaatccgcatttattccagttaggcttttgg
ccgggaggggatagagacgggaatccttttgtaaccgcagaaattactcaacgtgtatct
tcagaattaaggcttgctattcttaaatgttattatgaacatctgaagaaactccgcaag
agaattactttcccaaaagttaccgaaatgctgagacagattagtgaaagggtatatcag
aatattttcgaaaacaaatacgaccttactgccggagaattcaaaatagctttacaggat
ataagacatgaagtaaaagaaaataataacggattgtttattgataaaattgacgacctg
ataggccgtatagatttatttgggatctattttgcttcgctggacattcgccagaacagt
aaaatccattacaaagcgctggaacagatttttgaaaaagaatttggtaaagattaccat
gcattgaatgaagatgaaaaattgaatctgcttctcaacacttctttacaggttgatcct
gaaaattatagcgatgatatagtaaaggatacattgaaaaacatctatcaggtaaaagat
attcaggagctaaatggagagcaaagtattcaccgttatattatttcggacagttcttct
atttatgatgttctgaatgtttatgccttatttaaatattgtggttatgccgataaggat
ataaaaatagatattgttccgctgttcgaaaccatagaaggctttgaaaatgcagaggca
acaatgaacaggctttataaccttgctcaatataaagaacatctgaatcgccgtaatggc
agacaatttattatgcttggattttcggacggaacaaaagatgccgggtatataaaagca
aactgggatatttatacaaccaaagaagtactgtcaaaggtttcggatgaaaacgatatc
aaagtaatattctttgatggtagaggcgggcctcctgcacgtggtggtgggaaaacacac
cagttttatgcggcgcaggggaaaagtattgccaaccaccagatagaattaacaattcag
gggcaaacaattaccagcgtttttggaacgaaagatcaggcaactttcaactttgagcag
ttgcttacagcaggattagaaaatgaaatttttcctcaggacaaaataaatctgaaagat
tgggaaagagctttgctaaatgagcttgccggaattagctaccagaaatataaagcactg
aaagatcatcctctttttgtaccttatctggaagaggttagtacactgaaatattatgga
cgtaccaatatcggaagccgtccgagtaagagaaatgacggtcagctggtattcgaagat
ctgagagcaatcccgtttgtaggatcatggagtttgctaaaacaaaatgtacccggatac
ttcggagtgggtacggctttacaaagattaaaagaagagggaagactggaagatttgaaa
aaactatacagagaatctatgttcttcaagacccttattcagaatagtatgatgtctatg
agcaagacttactttccactgacctattatctgcgtaatgacaaagtatttggtgaattt
tggcagatcctgcacaatgaatacctgctgactcatgaaatgttattggaaatagccaat
tacaaatctctgatggaggaagaaccattgtctaagagttctattaaaatgagagaaaat
attgtgctgccgttgctaaccattcagcaatatgctttacaaaagattaaagaagagaat
ccgcataaagaaacctatgaaaagattgtcacaagggcattattcggaaatattaatgcg
agtcgtaattcagcatag

DBGET integrated database retrieval system