KEGG   Escherichia coli clone D i2: i02_0472Help
Entry
i02_0472          CDS       T02004                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00730  Thiamine metabolism
eld00790  Folate biosynthesis
eld01100  Metabolic pathways
eld02020  Two-component system
Module
eld_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    i02_0472 (phoA)
   00790 Folate biosynthesis
    i02_0472 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    i02_0472 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eld04147]
    i02_0472 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eld00537]
    i02_0472 (phoA)
Enzymes [BR:eld01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     i02_0472 (phoA)
Exosome [BR:eld04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   i02_0472 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eld00537]
 Enzymes
  i02_0472 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AER83064
LinkDB All DBs
Structure
PDB: 

Position
477247..478731
Genome map
AA seq 494 aa AA seqDB search
MSRPRLIVALFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGD
ITAPGGAHRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGI
DALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEM
AKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQL
LNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDTASLNSVTEANQQKPL
LGLFADGNMPVRWQGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEK
GFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQ
IVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQ
TDLFYTMKAALGLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacggccgagacttatagtcgctttgtttttattttttaatgtatttgtacatgga
gaaaataaagtgaaacaaagcactattgcactggcactcttaccgttactgtttacccct
gtgacaaaagcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgat
attactgcacccggcggtgctcaccgcttaacgggtgatcagaccgccgctctgcgtgat
tctcttagcgataaacctgcaaaaaatattattttgctgattggcgatgggatgggggac
tcggaaattactgccgcacgcaattatgccgaaggtgcgggcggcttttttaaaggtatc
gatgccttaccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaa
ccggactacgtcaccgactcggctgcatcagcaaccgcctggtcaactggtgtcaaaacc
tataacggcgcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatg
gcaaaagccgcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacg
cccgctgcgctggtggcgcatgtgacctcgcgcaaatgctacggtccgagtgcgaccagt
gaaaaatgtccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctg
cttaacgcccgtgccgatgttacgcttggcggcggtgcaaaaacctttgctgaaacggca
accgccggtgaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcag
ttggtgagcgatactgcctcactgaattcggtgacggaagcgaatcagcaaaaaccccta
ttaggactgtttgctgacggcaatatgccagtgcgctggcaaggaccgaaagcaacgtac
cacggtaatatagataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagt
gtaccgaccctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaa
ggctttttcctgcaagttgaaggtgcgtcaatcgataaacaggatcacgcagcgaatcct
tgtgggcaaattggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattc
gctaaaaaggatggtaacacgttggtcatagtcaccgctgatcacgcccatgccagccag
atagttgcgccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggc
gcagtgatggtgatgagttacgggaactccgaagaggattcacaagaacataccggcagt
cagttgcgtattgcagcgtatggcccacatgccgccaatgtcgttggactgaccgaccag
accgatctcttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system