KEGG   Escherichia coli clone D i2: i02_0859Help
Entry
i02_0859          CDS       T02004                                 

Gene name
glnP
Definition
(GenBank) glutamine ABC transporter permease protein
  KO
K10037  glutamine transport system permease protein
Organism
eld  Escherichia coli clone D i2
Pathway
eld02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eld00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    i02_0859 (glnP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eld02000]
    i02_0859 (glnP)
Transporters [BR:eld02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    i02_0859 (glnP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AER83446
LinkDB All DBs
Position
complement(868926..869585)
Genome map
AA seq 219 aa AA seqDB search
MQFDWSAIWPAIPLLIEGAKMTLWISVLGLAGGLVIGLLAGFARTFGGWIANHVALVFIE
VIRGTPIVVQVMFIYFALPMAFNDLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGF
REAGLALGLSRWETIRYVILPLALRRMLPPLGNQWIISIKDTSLFIVIGVAELTRQGQEI
IAGNFRALEIWSAVAVFYLIITLVLSFILRRLERRMKIL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgactggagtgccatctggcctgccattccgcttctgattgaaggtgccaaa
atgaccctgtggatttcggtcctcggtctggctggcggtctggtgatcggattgttggca
ggttttgcacgcaccttcggtggttggatagccaaccacgtcgcgctggtctttattgaa
gtgatccgcggcacacctatcgtcgtccaggtgatgtttatctatttcgccctgccgatg
gcgtttaacgatttacgcatcgacccgtttactgcggcggtggtcaccatcatgatcaac
tccggcgcgtacattgcggaaatcacgcgtggtgcggtgctgtctattcacaaaggtttt
cgtgaagcaggactggcgctcggtctttcacgttgggaaaccattcgctacgtcatttta
ccgctggcactgcgtcgtatgctgccgccgctgggtaaccagtggatcatcagcattaaa
gacacttcgctgtttattgttatcggcgtggcggaactgacccgtcaggggcaagaaatt
attgccggtaacttccgcgcccttgagatctggagcgccgtggcggtgttctatctgatt
attaccctggtgctgagctttattctgcgtcgtctggaaagaaggatgaaaatcctgtga

DBGET integrated database retrieval system