KEGG   Escherichia coli clone D i2: i02_1744Help
Entry
i02_1744          CDS       T02004                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00250  Alanine, aspartate and glutamate metabolism
eld00410  beta-Alanine metabolism
eld00430  Taurine and hypotaurine metabolism
eld00650  Butanoate metabolism
eld01100  Metabolic pathways
eld01110  Biosynthesis of secondary metabolites
eld01120  Microbial metabolism in diverse environments
eld02024  Quorum sensing
Module
eld_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    i02_1744 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    i02_1744 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    i02_1744 (gadB)
   00430 Taurine and hypotaurine metabolism
    i02_1744 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    i02_1744 (gadB)
Enzymes [BR:eld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     i02_1744 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 PRTase_3
Motif
Other DBs
NCBI-ProteinID: AER84314
LinkDB All DBs
Structure
PDB: 

Position
complement(1699735..1701204)
Genome map
AA seq 489 aa AA seqDB search
MHLLTLSINPTFLMRSNHFKEFKMDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEM
RDDVAFQIINDELYLDGNARQNLATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAID
LRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNL
VCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNY
EFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKF
GLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGRE
GYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSE
RLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGI
AQQNSFKHT
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgcacttgcttactttatcgataaatcctacttttttaatgcgatccaatcattttaag
gagtttaaaatggataagaagcaagtaacggatttaaggtcggaactactcgattcacgt
tttggtgcgaagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatg
cgtgatgatgtcgcattccagattatcaatgatgaattatatcttgatggcaacgctcgt
cagaacctggccactttctgccagacctgggacgacgataatgtccataagttgatggat
ttatccattaacaaaaactggatcgacaaagaagaatatccgcaatctgcagcaatcgat
ctgcgttgcgtaaacatggttgccgatctgtggcatgcgcctgcaccgaaaaatggtcag
gccgttggcaccaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatg
aaatggcgttggcgcaagcgtatggaagctgcaggtaagccgactaacaaaccgaacctg
gtgtgcggtccggtacaaatctgctggcataaattcgcccgctactgggatgtggagttg
cgtgagatccctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcc
tgcgacgaaaacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactat
gagttcccgcagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgac
atcgacatgcacatcgacgccgccagcggtggcttcctggcaccgttcgtcgccccggat
atcgtctgggacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattc
ggtctggctccgctgggctgcggctgggttatctggcgtgatgaagaagcgctgccgcag
gaactggtgttcaacgttgactacctcggcggtcagattggtactttcgccatcaacttc
tcccgcccggcgggtcaggtgattgcacagtactatgaattcctgcgcctcggtcgtgaa
ggctatacaaaagtacagaacgcttcctaccaggttgctgcttatctggcggatgaaatc
gccaaactggggccgtatgagttcatctgtacgggtcgcccggacgaaggcatcccggcg
gtttgcttcaaactgaaagatggtgaagatccgggatacaccctgtatgacctctctgaa
cgtctgcgtctgcgcggctggcaggttccggccttcactctcggcggtgaagccactgac
atcgtggtgatgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttg
ctggaagactacaaagcctccctgaaatatctcagcgaccacccgaaactgcagggtatt
gcccagcagaacagctttaaacacacctga

DBGET integrated database retrieval system