KEGG   Escherichia coli clone D i2: i02_2683Help
Entry
i02_2683          CDS       T02004                                 

Gene name
fadJ
Definition
(GenBank) multifunctional fatty acid oxidation complex
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00071  Fatty acid degradation
eld00280  Valine, leucine and isoleucine degradation
eld00281  Geraniol degradation
eld00310  Lysine degradation
eld00362  Benzoate degradation
eld00380  Tryptophan metabolism
eld00410  beta-Alanine metabolism
eld00640  Propanoate metabolism
eld00650  Butanoate metabolism
eld00903  Limonene and pinene degradation
eld00930  Caprolactam degradation
eld01100  Metabolic pathways
eld01110  Biosynthesis of secondary metabolites
eld01120  Microbial metabolism in diverse environments
eld01130  Biosynthesis of antibiotics
eld01200  Carbon metabolism
eld01212  Fatty acid metabolism
Module
eld_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    i02_2683 (fadJ)
   00650 Butanoate metabolism
    i02_2683 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    i02_2683 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    i02_2683 (fadJ)
   00310 Lysine degradation
    i02_2683 (fadJ)
   00380 Tryptophan metabolism
    i02_2683 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    i02_2683 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    i02_2683 (fadJ)
   00281 Geraniol degradation
    i02_2683 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    i02_2683 (fadJ)
   00930 Caprolactam degradation
    i02_2683 (fadJ)
Enzymes [BR:eld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     i02_2683 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     i02_2683 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     i02_2683 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AER85234
LinkDB All DBs
Position
complement(2676308..2678452)
Genome map
AA seq 714 aa AA seqDB search
MEMASAFTLNVRLDNIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKDLRGVVFISA
KPDNFIAGADINMIANCKTAQEAEALARQGQQLMAEIHALPVPVIAAIHGACLGGGLELA
LACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQAL
KLGLVDDVVPHSILLEAAVELAKQDRPSSRPLPVRERILAGPLGRALLFKMVGKKTEQKT
QGNYPATKRILDVIETGLAQGTSSGYDAEARAFGELAMTPQSQALRNIFFASTEVKKDPG
SDAPPAPLNSVGILGGGLMGGGIAYVTACKAGLPVRIKDINPQGINHALKYSWDQLEGKV
RRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIF
ASNTSSLPIADIAAHAARPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQ
GKTPIVVRDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPA
IYPLIGAQGQGRLSAPQVAERCVMLMLNEAVRCLDEQVIRSVRDGDIGAVFGIGFPPFLG
GPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMSKRGESFWKTTATDLQ
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcatcagcgtttacccttaatgtccgtctggacaacattgctgttatcacc
atcgacgtaccgggtgagaaaatgaataccctgaaggcggagtttgcctcgcaggtgcgc
gccattattaaacaactccgcgaaaataaagatctgcgcggtgtggtgtttatctccgcg
aaaccggacaactttatcgctggtgcagacatcaatatgatcgccaactgcaaaacggcg
caagaagcggaagcactggcgcggcagggtcaacagttaatggcggagattcatgctttg
cccgttccggttatcgcggctattcatggcgcttgcctgggcggcgggctggagctggcg
ctggcgtgccacggtcgcgtgtgtactgatgatcctaaaacggtactcggtttgcctgaa
gtacaacttggattgttacccggttcaggcggcacccagcgtttaccgcgcctgataggt
gtcagcacagcattagagatgatcctcaccggaaaacaacttcgggcgaaacaggcatta
aagctggggctggtggatgacgttgttccgcactccattttgctggaagccgctgttgag
ctggcaaagcaggatcgtccatcttcacgccctctacctgtacgcgagcgtattctggcg
gggccgttaggtcgtgcgctgctgttcaaaatggtcggcaagaaaacagagcaaaaaact
cagggtaactatccagcgacgaaacgcattcttgacgttattgaaaccggtttagcgcag
gggaccagcagtggctatgacgccgaagctcgggcgtttggtgaactggcgatgacgccg
caatcacaggcgctgcgcaatatcttttttgccagtacggaagtgaaaaaagatcccggc
agtgatgcgccgcctgcgccattaaacagcgtggggattctaggtggtggcttgatgggc
ggcggtattgcttatgtcactgcttgtaaagcggggcttccggtcagaattaaagatatc
aacccgcagggcataaatcatgcattgaagtacagctgggatcagttggagggcaaagtt
cgccgtcgtcatctcaaagccagcgaacgtgacaaacagctggcattaatctccggaacg
acggactatcgcggctttgcccatcgcgatctgattattgaagcggtgtttgaaaatctc
gaattaaaacaacagatggtggcggaagtggagcaaaattgcgccgctcataccatcttt
gcttcgaatacgtcatctttaccgattgccgatatcgccgctcacgccgcgcgacctgag
caagttattggcctgcatttcttcagtccggtggaaaaaatgccgctggtggagattatt
cctcatgcggggacatcggcgcaaaccatcgctaccacagtaaaactggcgaaaaaacag
ggcaaaacgcccattgtcgtgcgtgacaaagccgggttttacgtcaatcgcattttagcg
ccttacattaatgaagctatccgcatgttgaccgaaggtgaacgggtagagcacattgat
gccgcgctggtgaaatttggttttccggtaggcccaatccaacttttggatgaggtagga
atcgacaccgggactaaaattattcctgtactggaagccgcttatggagaacgttttagc
gcgcctgcaaatgttgtttcttcaattttgaacgacgatcgcaaaggcagaaaaaatggc
cggggtttctatctttatggtcagaaagggcgtaaaagcaaaaaacaggtcgatcccgcc
atttacccgctcattggcgcacaagggcaggggcgactctccgcaccgcaggttgctgaa
cggtgtgtgatgttgatgctgaatgaagcagtacgttgtctggacgagcaggttatccgt
agcgtgcgtgacggggatataggcgcggtatttggcattggttttccgccatttctcggt
ggaccgttccgctatatcgattctctcggcgcaggcgaagtggttgcaataatgcaacga
ctggccacgcagtatggttcccgttttaccccttgcgagcgtttagtcgagatgagcaag
cgtggggaaagtttttggaaaacaactgcaactgacctgcaataa

DBGET integrated database retrieval system