KEGG   Escherichia coli clone D i2: i02_2787Help
Entry
i02_2787          CDS       T02004                                 

Gene name
tktB
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00030  Pentose phosphate pathway
eld01100  Metabolic pathways
eld01110  Biosynthesis of secondary metabolites
eld01120  Microbial metabolism in diverse environments
eld01130  Biosynthesis of antibiotics
eld01200  Carbon metabolism
eld01230  Biosynthesis of amino acids
Module
eld_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
eld_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    i02_2787 (tktB)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    i02_2787 (tktB)
Enzymes [BR:eld01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     i02_2787 (tktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C SPATA1_C
Motif
Other DBs
NCBI-ProteinID: AER85336
LinkDB All DBs
Position
2787468..2789471
Genome map
AA seq 667 aa AA seqDB search
MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLKHNPTDPTWYDRDRFI
LSNGHASMLLYSLLHLTGYDLPLEELKNFRQLHSKTPGHPEIGYTPGVETTTGPLGQGLA
NAVGLAIAERTLAAQFNQPDHEIVDHFTYVFMGDGCLMEGISHEVCSLAGTLGLGKLIGF
YDHNGISIDGETEGWFTDDTAKRFEAYHWHVIHEIDGHDPQAVKEAILEAQSVKDKPSLI
ICRTVIGFGSPNKAGKEEAHGAPLGEEEVALARQKLGWHHPPFEIPKEIYHAWDAREKGE
KAQQSWNEKFAAYKKAHPQLAEEFTRRMSGGLPKDWEKTTQKYINELQANPAKIATRKAS
QNTLNAYGPMLPELLGGSADLAPSNLTIWKGSVSLKEDPAGNYIHYGVREFGMTAIANGI
AHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVYTHDSIGLGEDGPTHQAVEQLAS
LRLTPNFSTWRPCDQVEAAVGWKLAVERHNGPTALILSRQNLAQVERTPDQVKEIARGGY
VLKDSGGKPDIILIATGSEMEITLQAAEKLAGEGRNVRVVSLPSTDIFDAQDEKYRESVL
PSNVSARVAVEAGIADYWYKYVGLKGAIVGMTGYGESAPADKLFPFFGFTAENIVAKAHK
VLGVKGA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaaaagaccttgccaatgcgattcgtgcactcagtatggatgcggtacaaaaa
gccaattctggtcatcccggcgcgccgatgggcatggctgatattgccgaagtgctgtgg
aacgattttcttaaacataaccccaccgacccaacctggtatgaccgtgaccgctttatt
ctttccaacggtcacgcgtcgatgctgctctacagtttgctgcatctgaccggttacgac
ctgccactggaagaactgaagaacttccgtcagttgcattcgaaaacccctggtcacccg
gaaatcggctatacgccaggtgttgaaaccaccaccggtcctcttggacaaggtttggcg
aacgccgtcgggctggcgatagcagagcgtacgctggcggcgcaatttaatcagccggat
catgaaattgtcgatcacttcacctatgtgtttatgggcgacggctgcctgatggaaggt
atctctcacgaagtctgttcgctggcgggcacgctggggctgggcaagctgattggtttt
tacgatcacaacggtatttccatcgacggtgaaaccgaaggctggtttaccgacgatacg
gcaaaacgttttgaagcctatcactggcatgtgatccatgaaatcgacggccacgatccg
caggcggtgaaggaagcgatccttgaagcgcaaagcgtgaaagataagccgtcgctgatt
atctgccgtacggtgattggctttggttcgccgaataaagcaggtaaggaagaggcgcac
ggcgcaccgctgggggaagaagaagtagctctggcacggcaaaaactgggctggcaccat
ccgccatttgagatccctaaagagatttatcacgcctgggatgcccgtgaaaaaggcgaa
aaagcgcagcagagctggaatgagaagtttgccgcctataaaaaggctcatccgcaactg
gcagaagagtttacccgtcggatgagcggcggtttgccgaaggactgggagaaaacgact
cagaaatatatcaatgagttgcaggcgaatccggcgaaaatcgctacccgtaaggcttcg
caaaatacgcttaacgcttacgggccgatgctgcctgagttgctcggcggttcggcggat
ctggctcccagcaacctgaccatctggaaaggttctgtttcgctgaaggaagatccggcg
ggcaactacattcactacggggtgcgtgaatttggtatgaccgctatcgccaacggcatc
gcgcaccacggcggctttgtgccgtataccgcgacgttcctgatgtttgttgaatacgcc
cgtaacgccgcgcggatggcggcactgatgaaagcgcggcagattatggtttatacccac
gactcaattggtctgggcgaagatggtccgacgcaccaggctgttgagcaactggctagt
ctgcgcttaacgccaaatttcagcacctggcgaccgtgcgatcaggtggaagcggcggtt
ggctggaagctggcggttgagcgccacaacggaccgacagcactgatcctctcaaggcag
aatctggcacaggtagaacgaacaccggatcaggttaaagagattgctcgtggcggttat
gtgctgaaagacagcggcggtaagccagatattattctgattgccaccggttcagagatg
gaaatcaccctgcaagcggcagagaaattagcgggagaaggtcgcaatgttcgcgtagtt
tccctgccctcgaccgatattttcgatgcccaggatgagaaatatcgggagtcggtactg
ccttcaaatgtttctgcccgcgtggcagtagaagcgggtattgccgattactggtacaaa
tatgttggcctgaaaggggcaattgtcgggatgacaggttatggggaatcagctccggcg
gataagctgttcccgttctttggctttaccgccgagaatattgtggcaaaagcgcataag
gtactgggagtgaaaggtgcctga

DBGET integrated database retrieval system