KEGG   Escherichia coli clone D i2: i02_2941Help
Entry
i02_2941          CDS       T02004                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00250  Alanine, aspartate and glutamate metabolism
eld00280  Valine, leucine and isoleucine degradation
eld00410  beta-Alanine metabolism
eld00640  Propanoate metabolism
eld00650  Butanoate metabolism
eld01100  Metabolic pathways
eld01120  Microbial metabolism in diverse environments
Module
eld_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    i02_2941 (gabT)
   00650 Butanoate metabolism
    i02_2941 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    i02_2941 (gabT)
   00280 Valine, leucine and isoleucine degradation
    i02_2941 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    i02_2941 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eld01007]
    i02_2941 (gabT)
Enzymes [BR:eld01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     i02_2941 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     i02_2941 (gabT)
Amino acid related enzymes [BR:eld01007]
 Aminotransferase (transaminase)
  Class III
   i02_2941 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AER85487
LinkDB All DBs
Structure
PDB: 

Position
2959962..2961248
Genome map
AA seq 428 aa AA seqDB search
MRMSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHL
HPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENA
VKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGI
SEDDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIA
DEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTY
AGNPIACVAALEVLKVFEQENLLQKANVLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIE
LFEDGEHSKPDVKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIIS
QCFAEAKQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggc
gttgggcaaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgtt
gaaggccgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctg
catccgaaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttc
caggtgctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccg
ggcgattttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcg
gtgaaaatcgcccgcgccgccaccaaacgtagcgggaccatcgcctttagcggtgcgtat
cacgggcgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggc
atggggctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcata
agcgaggatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaa
gatatcgccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacg
ccagcctttatgcagcgtttacgcgcgctgtgtgacgagcatgggatcatgctgattgcc
gatgaagtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggc
gtggcaccagatctcaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggc
gtcaccgggcgcgcggaagtgatggacgccgtcgcaccgggcggactgggtggcacctat
gccggtaacccgattgcctgcgtagcggcgctggaagtgttgaaggtgttcgagcaggaa
aatctgctgcaaaaagccaacgttctggggcagaagctgaaagacggattgctggcgatc
gccgaaaaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccatcgag
ctgtttgaagatggcgaacacagcaaaccggacgtaaaactcaccgccgagatcgtggca
cgcgcccgcgataagggtctgattcttctctcctgcggcccgtattacaacgtgctgcgc
atccttgtaccgctcaccattgaagacgctcagatccgtcagggtctggaaatcatcagc
cagtgttttgctgaggcgaagcagtag

DBGET integrated database retrieval system