KEGG   Escherichia coli clone D i2: i02_2942Help
Entry
i02_2942          CDS       T02004                                 

Gene name
gabP
Definition
(GenBank) gamma-aminobutyrate transporter
  KO
K11735  GABA permease
Organism
eld  Escherichia coli clone D i2
Brite
KEGG Orthology (KO) [BR:eld00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eld02000]
    i02_2942 (gabP)
Transporters [BR:eld02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   i02_2942 (gabP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 Spore_permease
Motif
Other DBs
NCBI-ProteinID: AER85488
LinkDB All DBs
Position
2961422..2962885
Genome map
AA seq 487 aa AA seqDB search
MTRRGKCRGALPSDTLSRGFRMGQSSQPHELGGGLKSRHVTMLSIAGVIGASLFVGSSVA
IAEAGPAVLLAYLFAGLLVVMIMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYW
WFWVLVIPLEANIAAMILHSWVPGIPIWLFSLVITLALTGSNLLSVKNYGEFEFWLALCK
VIAILAFIFLGAVAISGFYPYADVSGISRLWDSGGFMPNGFGAVLSAMLITMFSFMGAEI
VTIAAAESDTPEKHIVRATNSVIWRISIFYLCSIFVVVALIPWNMPGLKAVGSYRSVLEL
LNIPHAKLIMDCVILLSVTSCLNSALYTASRMLYSLSRRGDAPAVMGKINRSKTPYVAVL
LSTGAAFLTVVVNYYAPAKVFKFLIDSSGAIALLVYLVIAVSQLRMRKILRAEGSEIRLR
MWLYPWLTWLVIGFITFVLVVMLFRPAQQLEVISTGLLAIGIICTVPIMARWKKLIMWQK
TPIHNTR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgacgcgggaaatgtcggggcgctctcccaagtgacacactttcgagaggattc
aggatggggcaatcatcgcaaccacatgagttaggcggcgggctgaagtcacgccacgtc
accatgttgtctattgccggtgttatcggcgcaagtctgtttgtcggttccagcgtcgcc
atcgccgaagcgggcccggcggtattactggcctatctgttcgccggattactggtggtt
atgattatgcggatgttggcggaaatggcggttgccacgcccgataccggttcattttcc
acctatgccgataaagccattggccgctgggcgggctataccatcggctggttgtactgg
tggttttgggtactggttatcccacttgaagccaacatcgccgccatgatcctgcactcg
tgggttccaggcattcccatctggttattttccctcgtcattaccctcgccttaaccggc
agtaatttattaagcgttaaaaactacggcgaatttgagttctggctggcgctgtgtaaa
gtcatcgctatcctggcctttattttccttggtgccgtcgcaattagcggtttttacccg
tatgccgacgtgagcggtatttcaagattgtgggatagcggcggctttatgcccaacggc
ttcggtgcggtattaagcgcgatgttgatcaccatgttctcgtttatgggcgcagaaatt
gtcaccattgccgccgcggaatccgacacgccggaaaaacatattgtccgcgccaccaac
tcggttatctggcgtatctctattttctatttgtgttctatttttgtcgttgtggcatta
atcccgtggaatatgccagggctgaaagccgttggttcttatcgctcggttctggaattg
ctcaatattcctcatgcgaaattaatcatggactgcgtgatattactttccgtaaccagc
tgcctgaactcggcgctgtataccgcttccaggatgctctactccttaagccgtcgcggt
gatgctcccgcggtaatgggtaaaatcaaccgcagtaaaaccccgtacgtggcggtgtta
ctctccaccggcgcggcattcttaacggtggtggtgaactattacgcgcctgcgaaggtg
tttaaatttctgatcgacagctccggcgctatcgccctgctggtttatttagtcatcgcc
gtttcacaattgcggatgcgcaaaattctgcgagcagaaggaagcgaaattcgcctgcgg
atgtggctttatccgtggctcacctggctggtcatcggctttattacctttgtgttggta
gtgatgctattccgcccggcgcaacagttagaagtgatctccaccggcttattagcgatt
gggattatctgtaccgtgccaattatggctcgctggaaaaagctgataatgtggcaaaaa
acacccattcataatacgcgctga

DBGET integrated database retrieval system