KEGG   Escherichia coli clone D i2: i02_3202Help
Entry
i02_3202          CDS       T02004                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase BglA
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00010  Glycolysis / Gluconeogenesis
eld00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eld00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    i02_3202 (bglA)
   00500 Starch and sucrose metabolism
    i02_3202 (bglA)
Enzymes [BR:eld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     i02_3202 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AER85744
LinkDB All DBs
Structure
PDB: 

Position
3227614..3229071
Genome map
AA seq 485 aa AA seqDB search
MTHLEPMIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKE
VVPGKYYPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFY
DDMIDELLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKY
WMTFNEINNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAAHRINP
EMKVGCMLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNI
KMEDGDLDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQID
PVGLRYALCELYERYQKPLFIVENGFGAYDKVEDDGSINDDYRIDYLRAHIEEMKKAVTY
DGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIAS
NGENL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttgactcatctggagcctatgatagtgaaaaaactcaccttaccgaaagatttcttatgg
ggcggcgcagttgccgctcatcaggtcgaaggcggctggaacaaaggcggcaaagggccg
agcatttgtgacgttttgaccggtggcgcacacggcgtgccgcgcgaaatcaccaaagaa
gttgtgcctggcaaatactatccaaaccatgaagccgttgatttttatggtcactacaag
gaggacatcaagctatttgccgaaatgggcttcaaatgttttcgtacttccatcgcctgg
acgcgcatttttccaaaaggcgatgaagctcagccaaacgaagaagggctgaagttctac
gatgatatgatcgatgaactgctgaaatacaacatcgaaccggtgatcaccctctcccac
tttgaaatgccgctgcatctggtgcagcaatacggtagctggaccaaccgtaaagtggtt
gatttctttgtccgtttcgcggaagtggtattcgaacgctataagcacaaagtcaaatac
tggatgaccttcaacgaaattaacaaccagcgtaactggcgtgcaccgctgttcggttac
tgctgctccggcgtggtgtataccgaacatgaaaacccggaagagaccatgtatcaggtg
ctgcatcaccagtttgtcgccagcgccctggcggtgaaagccgcgcatcgcatcaacccg
gagatgaaagtcggttgtatgctggcgatggtgccgctctatccttactcctgtaacccg
gacgatgtgatgtttgcccaggagtcgatgcgcgaacgttacgtctttaccgatgtgcag
ttgcgtggctattacccgtcctatgtgttgaacgagtgggaacgccgcggatttaacatc
aaaatggaagacggcgatctggatgtactgcgcgaaggcacctgcgattatctcggcttc
agctattacatgaccaacgcggtgaaggccgaaggtggcaccggcgatgcgatttctggt
ttcgaaggcagcgtaccgaatccgtatgttaaagcgtctgactggggctggcagattgat
ccggttggtctgcgctacgcactttgcgagctgtatgagcgttaccagaagccgctgttt
attgtcgaaaacggttttggcgcttacgacaaagtggaagatgatggcagcatcaatgac
gattaccgcattgattacctgcgtgcccatattgaagagatgaaaaaagcggtgacttac
gatggcgtggacctgatgggctacacgccgtggggctgcatcgactgtgtgtcgttcacc
accgggcagtacagcaaacgctacggctttatctatgtgaataaacatgacgacggtact
ggcgatatgtcgcgttcacgtaagaagagctttaactggtacaaagaggtgattgccagc
aacggcgagaatctgtaa

DBGET integrated database retrieval system