KEGG   Escherichia coli clone D i2: i02_3838Help
Entry
i02_3838          CDS       T02004                                 

Gene name
mrcA
Definition
(GenBank) peptidoglycan synthetase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00550  Peptidoglycan biosynthesis
eld01100  Metabolic pathways
eld01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    i02_3838 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    i02_3838 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eld01003]
    i02_3838 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eld01011]
    i02_3838 (mrcA)
Enzymes [BR:eld01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     i02_3838 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     i02_3838 (mrcA)
Glycosyltransferases [BR:eld01003]
 Polysaccharide
  Bacterial polysaccharide
   i02_3838 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:eld01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   i02_3838 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase DUF3502 Tudor_4
Motif
Other DBs
NCBI-ProteinID: AER86369
LinkDB All DBs
Position
3819981..3822533
Genome map
AA seq 850 aa AA seqDB search
MKFVKYFLILAVCCILLGAGSIYGLYRYIEPQLPDVATLKDVRLQIPMQIYSADGELIAQ
YGEKRRIPVTLDQIPPEMVKAFIATEDSRFYEHHGVDPVGIFRAASVALFSGHASQGAST
ITQQLARNFFLSPERTLMRKIKEVFLAIRIEQLLTKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKTVDQLTLNEMAVIAGLPKAPSTFNPLYSMDRAVARRNVVLSRMLDEGYITQQQF
DQTRTEAINANYHAPEIAFSAPYLSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQ
QAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNNKITDTLKALPTYGPLLPAAVTSANPQ
EATAMLADGSTVVLSMEGVRWARPYRSDTQQGPTPRKVTDVLQTGQQIWVRQVGDAWWLA
QVPEVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGL
TLASMLNDVPISRWDAGAGSDWQPKNSPPQYAGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHTESLALGSASFTPMQVARGYAVMANGGFLVDPWFISKIENDQG
GVIFEAKPKVACPECDIPVIYGDTQKSNVLENNDVEDVAISREQQNVSVPMPQLEQANQA
LVAKTGAQEYAPHVINTPLAFLIKSALNTNIFGEPGWQGTGWRAGRDLQRHDIGGKTGTT
NSSKDAWFSGYGPGVVTSVWIGFDDHRRNLGHTTASGAIKDQISGYEGGAKSAQPAWDAY
MKAVLEGVPEQPLTPPPGIVTVNIDRSTGQLANGGNSREEYFIEGTQPTQQAVHEVGTTI
IDNGEAQELF
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtattttttgatccttgcagtctgttgcattctgctgggagcaggc
tcgatttatggcctataccgctacatcgagccacaactgccggatgtggcgacattaaaa
gatgttcgcctgcaaattccgatgcagatttacagcgccgatggcgagctgattgctcaa
tacggtgagaaacgtcgtattccggttacgttggatcaaatcccgccggagatggttaaa
gcctttatcgcgacggaagacagccgcttctacgagcatcacggcgttgacccggtgggg
atcttccgtgcggcaagcgtggcgctgttctccggtcacgcgtcacaaggggcgagtacc
attacccagcagctggcgagaaacttcttcctcagtccagaacgcacactgatgcgcaag
attaaggaagtcttcctcgcgattcgcattgaacagttgctgacgaaagacgagatcctc
gagctttatctgaacaagatttacctcggttaccgcgcctatggtgtcggtgctgcggca
caagtctatttcggtaaaactgtcgaccaactgacgttgaacgaaatggcggtgatagcc
gggctgccgaaagcgccttccaccttcaacccgctctactcaatggatcgtgccgtcgca
cggcgtaacgtcgtgctgtcgcggatgctggatgaagggtatatcacccaacaacagttc
gatcagacacgcactgaggcgattaacgctaactatcacgcgccggagattgctttctct
gcgccatacctgagtgaaatggtgcgccaggagatgtataaccgttatggcgaaagtgcc
tatgaagacggttatcgcatttacaccaccatcacccgcaaagtgcagcaggccgcacag
caggcggtacgtaataacgtgctggactacgacatgcgccacggctatcgcggcccggca
aatgtgctgtggaaagtgggcgaatcggcgtgggacaacaacaaaattaccgatacgctg
aaggcgctgccgacctatggtccgctgctgcctgccgcagtcaccagcgccaatcctcag
gaagcaacagcgatgctggcagacgggtcgaccgtcgtattgagtatggaaggtgttcgc
tgggcgcgcccttaccgttcggatactcagcagggaccgacgccgcgtaaagtgaccgat
gttctgcaaacgggtcagcaaatctgggttcgtcaagttggcgatgcatggtggctggca
caagtgccggaagtgaactcggcgctggtgtcgatcaatccgcaaaacggtgccgttatg
gcgctggtcggtggctttgatttcaatcagagcaagtttaaccgcgccacccaggcactg
cgtcaggtgggttccaacatcaaaccgttcctctacaccgcggcgatggataaaggtctg
acgctggcaagtatgttgaacgatgtgccaatttcccgctgggatgcaggtgccggttct
gactggcaaccgaagaactcaccaccgcaatatgccggtccaattcgcttacgtcagggg
ctgggtcagtcgaaaaacgtggtgatggtacgcgcaatgcgggcgatgggcgtcgactac
gctgcagaatatctgcaacgcttcggcttcccggcacaaaacattgtccacaccgaatcg
ctggcgctgggttcagcgtccttcaccccaatgcaggtggcgcgcggctacgcggtcatg
gcgaacggcggcttcctggtggacccgtggtttatcagcaaaattgaaaacgatcagggc
ggcgtgattttcgaagcgaaaccgaaagtagcctgcccggaatgcgatattccggtgatt
tacggtgatacgcagaaatcgaacgtgctggaaaataacgatgttgaagatgtcgctatc
tcccgcgagcagcagaatgtttctgtaccaatgccgcagctggagcaggcaaatcaggcg
ttagtggcgaagactggcgcgcaggagtacgcaccgcacgtcatcaacacaccgctggca
ttcctgattaagagtgccttgaacaccaatatttttggtgaaccaggctggcagggtact
ggctggcgagcaggtcgtgatttacaacggcatgatataggcggaaaaacgggtaccact
aacagttcgaaagatgcgtggttctcgggttacggtccgggcgttgtgacctcggtctgg
attggctttgatgatcaccgtcgtaatctcggtcatacaacggcttccggagcgattaaa
gatcagatctcaggttacgaaggcggtgccaagagtgcccagcctgcatgggacgcttat
atgaaagccgttcttgaaggtgtgccggaacagccgctgacgccgccaccgggtattgtg
acggtgaatatcgatcgcagcaccgggcaattagctaatggtggcaacagccgcgaagag
tatttcatcgaaggtacgcagccgacacaacaggcggtgcacgaggtgggaacgaccatt
atcgataatggcgaggcacaggaattgttctga

DBGET integrated database retrieval system