KEGG   Escherichia coli clone D i2: i02_3875Help
Entry
i02_3875          CDS       T02004                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eld  Escherichia coli clone D i2
Pathway
eld00564  Glycerophospholipid metabolism
eld01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eld00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    i02_3875 (glpD)
Enzymes [BR:eld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     i02_3875 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AER86405
LinkDB All DBs
Structure
PDB: 

Position
3859695..3861200
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNTHF
KKQLNRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDEDGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQRLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctactgaaaatggccccgcat
atcgctttcccgatgcgttttcgcctgccgcatcgtccgcatctacgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
accggtttgcgttttggcgcaaactcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggtgaagtgcttactcgtactcgtgccacgtctgctcgccgcgaaaacggc
ctgtggattgtggaggcggaagatatcgataccggcaaaaaatatacatggcaggcgcgc
ggcctggttaatgctaccggcccgtgggtgaaacaatttttcgacgacgggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acccagaagcaagcctacattctgcaaaacgaagataaacgtattgtcttcgtgatcccg
tggatggacgagttttccatcatcggcaccaccgatgtggaatacaaaggcgatccaaaa
gcagtgaagattgaagagagtgaaatcaattacctgttgaaagtgtataacacgcacttt
aaaaagcagttaaaccgggacgatatcgtctggacctactccggcgtgcgtccgctatgt
gatgatgagtccgactcgccacaggccattacccgtgattacacccttgatatccatgat
gaagacggcaaagccccgctgctgtcggtattcggcggtaagctgaccacctaccgcaaa
ctggcggagcacgcgctggaaaaactgacgccatattatcagggcattggtccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgtgacgattacgccgcc
cgcctgcgccgccgttacccgttcctgactgaatcgctggcacgtcactacgcgcgcact
tacggcagcaacagcgaactgctgctcggcaatgcaggggcgataagcgacctcggtgaa
gatttcggtcatgagttctacgaagcggagctgaaatatctggtcgaccacgaatgggtc
cgccgcgccgacgatgccctgtggcgtcgcacgaaacaaggcatgtggctaaatgcggat
caacaatctcgtgtgagtcagtggctggtggaatatacgcagcagaggttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system