KEGG   Escherichia coli clone D i2: i02_4342Help
Entry
i02_4342          CDS       T02004                                 

Definition
(GenBank) putative sugar phosphatase
Organism
eld  Escherichia coli clone D i2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase Hydrolase_6 HAD Trehalose_PPase
Motif
Other DBs
NCBI-ProteinID: AER86863
LinkDB All DBs
Position
4336421..4337338
Genome map
AA seq 305 aa AA seqDB search
MRSFLKRTQCAQSRSTLSLIFSTGITHPAETALQRFKFLMYQVVASDLDGTLLSPDHTLS
PYAKETLKLLTARGINFVFATGRHHVDVGQIRDNLEIKSYMITSNGARVHDLDGNLIFAH
NLDRDIASDLFGVVNDNPEIITNVYRDDEWFMNRHRPEEMRFFKEAVFNYALYEPGLLEP
EGVSKVFFTCDSHEKLLPLEQAINARWGDRVNVSFSTLTCLEVMAGGVSKGHALEAVAKK
LGYSLQDCIAFGDGMNDAEMLSMAGKGCIMGSAHQRLKDLHPELEVIGTNAEDAVPHYLR
KLYLS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagatcctttttgaaaaggacgcaatgcgctcagtcgcgctccacgctatcgttgatt
ttttcaacaggcataactcacccagcggaaaccgctctacagaggtttaaatttcttatg
taccaggttgttgcgtctgatttagatggcacgttactttctcccgaccatacgttatcc
ccttacgccaaagaaactctgaagctgctcaccgcgcgcggcatcaactttgtgtttgcg
accggtcgtcaccacgttgatgtggggcaaattcgcgataatctggagattaagtcttac
atgattacctccaatggcgcgcgcgttcacgatctggatggcaacctgatttttgctcat
aacctggatcgcgacattgccagtgacctgtttggcgtggtcaacgacaacccggagatc
attactaacgtttatcgcgatgatgaatggtttatgaatcgccatcgcccggaagagatg
cgctttttcaaagaagcggtgttcaattatgcgctgtatgagccgggattgctggagccg
gaaggcgtcagcaaagtgttcttcacctgcgattcccatgaaaaacttctgccactggag
caggcgattaacgctcgctggggcgatcgcgtcaatgtcagtttctctaccttaacctgc
ctggaagtgatggcgggcggcgtttcaaaaggccatgcgctggaagcggtggcgaagaaa
ctgggctacagcctgcaagattgtattgcctttggcgatggaatgaacgatgccgaaatg
ctgtcgatggcggggaaaggctgcattatgggcagcgcgcatcaacggctgaaagatctg
catccagagctggaagtgattggtactaacgccgaagacgcagtgccgcattatctgcgt
aagctctatttatcgtaa

DBGET integrated database retrieval system