KEGG   Eggerthella lenta: Elen_0149Help
Entry
Elen_0149         CDS       T00984                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ele  Eggerthella lenta
Pathway
ele00250  Alanine, aspartate and glutamate metabolism
ele00410  beta-Alanine metabolism
ele00430  Taurine and hypotaurine metabolism
ele00650  Butanoate metabolism
ele01100  Metabolic pathways
ele01110  Biosynthesis of secondary metabolites
ele01120  Microbial metabolism in diverse environments
ele02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Elen_0149
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Elen_0149
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Elen_0149
   00430 Taurine and hypotaurine metabolism
    Elen_0149
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Elen_0149
Enzymes [BR:ele01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Elen_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Acetyltransf_14
Motif
Other DBs
NCBI-ProteinID: ACV54143
UniProt: C8WJE1
LinkDB All DBs
Position
206635..208125
Genome map
AA seq 496 aa AA seqDB search
MKEQTSTSKILDSMDEGTKYSTPIFGSEASDVAMPRLKMNDKPVEPRITYEMIKEYLSIE
GNATQNLTTFCQTYMEPMATKIMAETMEKNAIDKDEYPMTADLENRCVAMIGNLWHADPA
EEPMGTSTVGSSEACMLGGLGMLFRWKKLAKDAGIDIYTAQRPNLVISAGYQVCWEKFCR
YWDIEMRLVPLEKDHLSLNMDTVMDYVDDHTIGIAAILGITYTGKFDDVQKLDELVEAYN
QQHPKLPIRIHVDGASGGMFAPFVEPDLVWDFQLKNVWSINCSGHKYGLVYPGIGWVVWR
SKEALPEDLIFWVSYLGGEEATMAINFSRSASQIVGQYYVLMRNGFEGFKEIQERTLDVA
RYLAAELKEMGVFEIYEDASHIPIVCWGLKDDAGVEWSLYDLSDRLRMSGWLVPAYPMPA
DMQDTTVQRVVARADFSMQLAIKLVEDMKKEMDTLNKAKFVTGNTQGVIRTGFNHGGRSA
VDKGEKVQTKAPTPQK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacagacatctaccagcaagatcctcgacagcatggacgagggcaccaagtac
tcgacgcccatcttcggctccgaggcgtccgacgtggccatgccgcgcctcaagatgaac
gataagccggtcgagccgcgcatcacgtacgagatgatcaaggaatacctgtccatcgag
ggcaacgccacgcagaacctcaccacgttctgccagacgtacatggagcccatggccacg
aagatcatggccgagacgatggagaagaacgccatcgacaaggacgagtaccccatgacg
gccgacctcgagaaccgctgcgtcgccatgatcggcaacctgtggcatgccgacccggcc
gaggagcccatgggcacgtccaccgtcggctcgtccgaggcgtgcatgctgggcggcttg
ggcatgctgttccgctggaagaagctggcgaaggacgcgggcatcgacatctacacggcg
cagcgccccaacctggtgatttccgcgggctaccaggtgtgctgggaaaaattctgccgc
tactgggacatcgagatgcgcctcgtgccgcttgagaaggaccacctgtcgctgaacatg
gacacggtcatggactacgtggacgaccacaccatcggcatcgcggccatcctgggcatc
acgtacaccggcaagttcgacgacgtgcagaagctcgacgagctggtggaagcgtacaac
cagcagcatccgaagctgccgatccgcattcacgtggacggcgcgtcgggcggcatgttc
gccccgttcgtcgagcccgacctggtatgggacttccagttgaagaacgtgtggtccatc
aactgctccggccacaagtacggcctcgtgtaccccggcatcggctgggtggtgtggcgc
agcaaggaggcgctgcccgaggacctgatcttctgggtgagctacctgggcggcgaggag
gccacgatggccatcaacttctcgcgctccgcgtcgcagatcgtgggccagtactacgtg
ctgatgcgcaacggcttcgagggcttcaaggagatccaggagcgcacgctcgacgtggca
cgctacctggccgccgagctcaaggagatgggcgtcttcgagatctacgaggacgcgtcg
cacattcccatcgtgtgctggggcttgaaggacgacgccggcgtggagtggtcgctgtac
gacctgtccgaccgcctgcgcatgagcggctggctggtgccggcgtacccgatgccggcc
gacatgcaggacaccaccgtccagcgcgtcgtggcgcgtgccgacttctcgatgcagctg
gccatcaagctggtcgaggacatgaagaaggagatggacacgctgaacaaggcgaagttc
gtcaccggcaacacccagggcgtcatccgcaccggcttcaaccacggcggccgctccgcc
gtcgacaagggcgaaaaggtgcagacgaaggccccgacgccccagaaataa

DBGET integrated database retrieval system