KEGG   Eggerthella lenta: Elen_2541Help
Entry
Elen_2541         CDS       T00984                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ele  Eggerthella lenta
Pathway
ele00061  Fatty acid biosynthesis
ele00620  Pyruvate metabolism
ele00640  Propanoate metabolism
ele01100  Metabolic pathways
ele01110  Biosynthesis of secondary metabolites
ele01120  Microbial metabolism in diverse environments
ele01130  Biosynthesis of antibiotics
ele01200  Carbon metabolism
ele01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ele00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Elen_2541
   00640 Propanoate metabolism
    Elen_2541
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Elen_2541
Enzymes [BR:ele01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Elen_2541
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Elen_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp LAL_C2 ATP-grasp_5 RimK ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACV56496
UniProt: C8WLN3
LinkDB All DBs
Position
complement(2972741..2974093)
Genome map
AA seq 450 aa AA seqDB search
MFKKILIANRGEVALRVMRACKELGVKTVAVYSTEDANTYPVQYADEAVCIGPAQANKSY
LIIPNIIAAAKTTGAEAVHPGYGFLAENADFARACADNDLVFIGPSPECIERMGDKSSAR
ETMKACGVPTVPGSDGCIETAAEAKAFADTVGYPVLIKATAGGGGKGMREVHDPADLEAQ
YAAARNEAGAAFGNDGVYLEKLVLRPRHVEIQVLADDFGNNIALCERDCSVQRRHQKLIE
EAPSPALTEDLRRAMGVAAIKAVRATNYKNAGTIEFLLDERGSFYFMEMNTRVQVEHPVT
EQITGTDIIKEQLRIASGEPMSCADRAPFSPAGHAMEFRINAEDPQHGFRPCPGTITKFE
APAGPGVRVESYVRTGSRISPYYDSLVAKLVVYGQDREEALARGRRALDEFVIEGIETTI
AFHRRVLDNAVFCSGDVTTDFIETQMGDVL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaagatcctgatcgccaaccgcggcgaggtcgccctgcgcgtcatgcgcgcc
tgcaaggagctgggcgtgaagacggtcgcggtctactcgaccgaggacgccaacacctac
cccgtgcagtacgccgacgaggccgtatgcatcggccctgctcaggcgaacaagagctac
cttatcataccgaacatcatcgcggcggcgaagaccaccggcgcggaggccgtgcatccc
ggctacggcttcctcgccgagaacgccgacttcgcccgcgcctgcgccgacaacgacctc
gtgttcatcgggcccagccccgagtgcatcgagcgcatgggcgacaagagctccgcgcgc
gagaccatgaaggcgtgcggcgtgcccaccgtcccgggctccgacggctgcatcgaaacg
gcggccgaggccaaggcgttcgccgacaccgtgggctatcccgtgctcatcaaggcgacg
gcaggcggcggcggcaagggcatgcgcgaagtgcacgacccggccgacctcgaggcgcag
tacgctgcggcccgcaacgaggccggcgccgcgttcggcaacgacggcgtgtacctggag
aagctcgtgctgcgcccgcgccacgtggagatccaggtgctggccgacgacttcggcaac
aacatcgccctgtgcgagcgcgactgctccgtgcagcgccgccatcagaagctcatcgag
gaagcgccctcgccggcgctgaccgaggacctgcgccgcgccatgggcgtggcggccatc
aaggccgtgcgcgccacgaactacaagaacgccggcaccatcgagtttctgctcgacgag
cgcgggtcgttctacttcatggagatgaacacgcgggtgcaggtggagcacccggtgacc
gagcagatcaccggcaccgacatcatcaaggagcagctgcgcatcgcctccggcgagcct
atgagctgcgccgatcgcgcgccgttctcgcctgcaggccatgcgatggaattccgcatc
aacgcggaagacccccagcatggcttccgtccgtgccccggcaccatcacgaagttcgag
gctccggccggccccggcgtgcgcgtggaaagctacgtgcgcacgggctcgcgcatctcg
ccctactacgactcgcttgtggcgaagctcgtggtgtacggccaggatcgcgaggaagcg
ctcgcgcgcggccgccgcgcgctcgacgagttcgtgatcgagggcatcgagaccacgatc
gcgttccatcgtcgcgtgctcgacaacgcggtgttctgctcgggcgacgtgaccaccgac
ttcatcgaaacccagatgggagacgtactatga

DBGET integrated database retrieval system