KEGG   Eggerthella lenta: Elen_2973Help
Entry
Elen_2973         CDS       T00984                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ele  Eggerthella lenta
Pathway
ele00620  Pyruvate metabolism
ele00680  Methane metabolism
ele01100  Metabolic pathways
ele01120  Microbial metabolism in diverse environments
ele01200  Carbon metabolism
Module
ele_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ele00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Elen_2973
  09102 Energy metabolism
   00680 Methane metabolism
    Elen_2973
Enzymes [BR:ele01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Elen_2973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACV56916
UniProt: C8WNX1
LinkDB All DBs
Position
complement(3450613..3453396)
Genome map
AA seq 927 aa AA seqDB search
MADLEGGTTLSLDRHLGASDTAEAIKSYTEIEIPESLRDNLVLFLRMERKVLKEYDPAVC
ALFDRLFNSMIRANEGNPGTVAADEPTDAQGIPTADTEGARAFREAVELIDALPVDQAQV
VVRAFTSFFHLANLSEENYRVETLRELERNVSMESAVDTSNELVVAYGHLLDEVGPERTA
ELLGRLEFHPVFTAHPTEARRKAVEGKIRRIAALLDEHPYLGGSALLENERHMLQEIDAL
VRTSPTELKKPTPLEEADTVIDIFDNTLFDTVPQVYRRFDDWVLGEDAGSVPPVCPAFFR
PGSWIGSDRDGNPNVTAKVSRRVAAKYFAHMVAKLAQECRNIGRNLTLESRYTAPSEELM
NLWSHLVEMSETLTGRVADDLGFEPHRAVMLVMAARLEGTVARNADIMYLSPEELLADLR
TVQDSLARAGAARAAYGPVQTLIWQVATFGFHMVEMEFRQHSLVHERALADIRSHGVLGK
LDPMTREVLDTFRAIGAIQKRYGQKMARRYIVSFTKSARHMADVYELAELAFSHAQDVPE
LDVIPLFEQLEDLENCVTVLDGMLQLPAVQRRLAQTGRRMEVMLGYSDSSKDAGPVTATL
ALHSAQERIARWAEERGIDVVLMHGRGGAVGRGGGPANRAVLAQPKGSVNCRFKVTEQGE
VIFARYGNRSLALRHIESVAAATLMNSAPSVERVNTEASVRFSDVAARLNEAAYERYLDL
LHTDGFAPWFSTVTPLAEVGLLPIGSRPAKRGLGAQSLDDLRTIPWVFSWSQARINLAAW
YGLGAACERVGDLELLQRAYREWPLFATFVDNVEMSIAKTDARIAKMYLALGDRDDLAQA
VFDEMQLTRSWALAIVGDEWPLQHRRVLGCAIRVRNPYVDALSLAQVRALRVIRNRQEEL
SDEVKTEYLGLILATVTGVSAGLQNTG
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggccgatctcgaaggcggaacaaccctttccctcgaccgtcatctaggcgcgtcggac
accgccgaggctatcaagtcctacacggagatcgagatccccgagagcctgcgcgacaac
ctcgtgctgttcctccgcatggagcgaaaggtgctcaaggagtacgatccggccgtctgc
gctctcttcgaccgtctgttcaacagcatgatcagggcgaacgagggcaacccgggcacc
gtcgccgcagacgagcccaccgatgcccagggcatccccacggccgacaccgagggcgcg
cgggcgttccgcgaggccgtcgagctcatcgacgcgttgccggtcgaccaagcgcaagtg
gtggtgcgcgcgttcacgtcgttcttccatctggcgaacctgtccgaggagaactaccgt
gtggaaacgctgcgcgagttggagcgcaacgtgtcgatggagtcggccgtggacacatcg
aacgagctggtggtggcgtacggccacctgctggacgaggtgggccccgaacgcacggcc
gagctgctgggtcgcttggaattccaccccgtgttcaccgcgcaccccactgaggcgcgc
cgcaaagcggtagagggcaagatccgccgtatcgccgcgttgctggacgagcatccctac
ctgggcggatcggctctcctggagaacgagcgccacatgctgcaggagatcgacgcgctc
gtgcgcacctcgcccaccgagctcaagaagcccacgcccctggaagaggccgacaccgtc
atcgacatcttcgacaacacgctgttcgatacagtgccgcaggtgtaccggcgtttcgac
gactgggtgctgggcgaggacgccggcagcgtgccgcccgtgtgcccggcgttcttccgt
ccgggcagctggatcgggtcggaccgcgacgggaacccgaacgtcacagcgaaggtgtcg
cgccgcgtggcggcgaagtacttcgcgcatatggtggccaagctggcccaagaatgccgc
aacatcgggcgcaacctcacgctggagtcgcggtacaccgcgccctcggaagagcttatg
aacctgtggagccatctcgtggagatgagtgagacgctgacgggacgggtggccgacgac
ctgggcttcgagccgcaccgcgccgtcatgctggtgatggccgcacgcctcgagggcacc
gtggcgcgcaacgccgacatcatgtacctgtcgcccgaagagctgctggccgacctgcgc
acggtgcaggactcgctcgcgcgcgccggtgccgcacgcgccgcgtacgggcccgtgcaa
acgctgatatggcaggttgcgacgttcgggttccatatggtggaaatggagttccgccag
cactcgctcgtgcacgaacgcgcgctagccgatatccgctcccatggcgtgctgggcaag
ctcgaccccatgacgcgcgaggtgctggacacgttccgcgccatcggcgccatccagaag
cgctacgggcagaagatggcccgacgctacatcgtgtcgttcaccaagagcgctcggcac
atggccgacgtctacgagctggcagagctcgcattctcgcacgcgcaggacgtgcccgag
ctggacgtgattcccttgttcgagcagctggaggacttggagaactgcgtcaccgtgctg
gacgggatgctgcagctgccggccgtgcagcgccgcctggcgcagacgggtcgacgcatg
gaggtcatgctgggctactcggactcttcgaaggacgccggccccgtcaccgccacgctc
gccctgcattccgcgcaggagcgcatcgcccgctgggccgaggagcgcggcatcgacgtc
gtgctcatgcacggtcgcggcggcgcggtgggccgcgggggcgggccggcgaaccgcgcg
gtgctcgcgcagccgaaggggtcggtgaactgccgattcaaggtgaccgagcagggcgag
gtcatcttcgcacgttacggcaaccgctcgcttgcgctgcgccatatcgaaagcgtcgcg
gcggccacgctcatgaactcggcgccgtcggtcgagcgcgtcaacaccgaggcatccgta
cgcttctccgatgtggccgcgcgtttgaacgaagccgcctacgagcgctatctggatctg
ctgcataccgacggcttcgcgccgtggttctccaccgtcacgcctttggccgaagtgggc
ctgctgcccatcggcagccgtcctgccaagcgcggcttgggagcccaatcgcttgacgac
ctgcgcaccatcccgtgggtgttctcgtggtcgcaggcgcgcatcaacctggctgcgtgg
tacggcctgggcgcggcgtgcgaacgggtgggtgacctggagcttctgcagcgcgcgtat
cgcgaatggcctctgttcgccacgttcgtcgacaacgtggagatgtccatcgccaaaacc
gacgcgcgtattgcgaagatgtacttggcgctgggcgaccgcgacgacctggctcaggcg
gtgttcgacgagatgcagctgacgcgttcgtgggcgctggccatcgtgggagacgagtgg
ccgctgcagcaccgccgcgtgcttggttgcgccatccgcgtgcgcaacccttacgtggac
gcgctctcgcttgcccaagtgcgcgcgttgcgcgtgatccgaaaccgacaggaagagctt
tcggacgaggtcaagaccgagtatctggggctcatcctggccaccgtgaccggggtttcc
gccggcctgcagaacacggggtag

DBGET integrated database retrieval system