KEGG   Eggerthella lenta: Elen_3114Help
Entry
Elen_3114         CDS       T00984                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ele  Eggerthella lenta
Pathway
ele00473  D-Alanine metabolism
ele00550  Peptidoglycan biosynthesis
ele01100  Metabolic pathways
ele01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ele00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Elen_3114
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Elen_3114
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Elen_3114
Enzymes [BR:ele01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Elen_3114
Peptidoglycan biosynthesis and degradation proteins [BR:ele01011]
 Precursor biosynthesis
  Amino acid ligase
   Elen_3114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACV57056
UniProt: C8WPW2
LinkDB All DBs
Position
complement(3623385..3624308)
Genome map
AA seq 307 aa AA seqDB search
MSECRVALLAGGKSGEREVSLASAEGAREALEEAGYTVTQLDPADKEDLKRLIDGPFDVA
FLCLHGKYGEDGTVQGLLETIGLPYIGSGVWSSALAMDKVKSKLYYEQAGILTPPSVPLQ
KGDSYDVDSIVEKLGTHCVVKPGTEGSALGVFIVEGAAAIGEAIEKAFDIDSEVLVERYI
KGKELTVAVIGDAEVEALPIIEIVPKSDFYDFESKYAPGGSQHLCPAPLSDETTRMVQEL
AVRAHRALSCEGVSRSDFILEEDGSCWTLETNTIPGMTGTSLLPDAARAAGISFPELCTR
LIGYALS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatgccgcgtggcgttgctcgccggaggaaagagcggggaacgcgaggtgtct
ctcgcatcggccgaaggcgcgcgagaggcccttgaagaagccggatataccgttacgcag
ctcgatcctgccgacaaggaggatctgaaacgtttgatcgacggtcctttcgacgttgct
tttctctgtttgcatgggaaatatggggaagacggcaccgtgcagggtcttttggaaacg
attgggctcccttatatcggtagcggggtgtggtcgagcgctttggcaatggataaagtg
aagtcgaagctgtactacgaacaagccggcatccttactcccccctctgtgccgctgcag
aagggagattcttacgacgtggattctatcgtcgagaagctgggcacgcattgtgtggtg
aaacccggcacggaaggaagtgcactgggggtgttcatcgtcgaaggtgctgcggcaatc
ggcgaagcaatcgagaaggcgttcgacatcgattcagaggttcttgttgaacgctatata
aaaggtaaggagttgacggttgcggtcattggcgacgcagaagtcgaagcgttgcctata
atcgaaatcgttcctaaaagcgatttctacgatttcgagtcgaaatatgctcccggtggt
tcgcagcacttgtgtcccgcgccgctgtcggatgaaacgacgcggatggtgcaagagctt
gcggttcgtgcccaccgcgcgttgtcgtgcgaaggggtttcgcgctctgatttcattttg
gaagaagacggttcgtgctggacgctggagacgaataccattcccggcatgacgggaaca
tcgctgcttcccgatgccgcgcgtgcggcgggcatttcttttccggaactctgtacgcgg
cttatcggttatgccctcagctaa

DBGET integrated database retrieval system