KEGG   Escherichia coli LF82: LF82_1656Help
Entry
LF82_1656         CDS       T00854                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
elf  Escherichia coli LF82
Pathway
elf00730  Thiamine metabolism
elf00790  Folate biosynthesis
elf01100  Metabolic pathways
elf02020  Two-component system
Module
elf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:elf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LF82_1656 (phoA)
   00790 Folate biosynthesis
    LF82_1656 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LF82_1656 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elf04147]
    LF82_1656 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elf00537]
    LF82_1656 (phoA)
Enzymes [BR:elf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LF82_1656 (phoA)
Exosome [BR:elf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LF82_1656 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elf00537]
 Enzymes
  LF82_1656 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: CAP74918
LinkDB All DBs
Structure
PDB: 

Position
405294..406709
Genome map
AA seq 471 aa AA seqDB search
MKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGDITAPGGARRLTGDQTAALRDSLS
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGLATGNVSTAELQDATPAA
LVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQARGYQLVSDTASLNSVTEANQQKPLLGLFADGNMPVRWQGPKATYHGN
IDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaa
gcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgatattactgca
cccggcggtgctcgccgcttaacgggtgatcagaccgccgctctgcgtgattctcttagc
gataaacctgcaaaaaatattattttgctgattggcgatgggatgggggactcggaaatt
actgccgcacgcaattatgccgaaggtgcgggcggcttttttaaaggtatcgatgcctta
ccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggcaaaccggactac
gtcaccgactcggctgcatcagcaaccgcctggtcaactggtgtcaaaacctataacggc
gcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatggcaaaagcc
gcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcg
ctggtggcgcatgtgacctcgcgcaaatgctacggtccgagtgcgaccagtgaaaaatgt
ccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgcc
cgtgccgatgttacgcttggcggcggtgcaaaaacctttgctgaaacggcaaccgccggt
gaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagc
gatactgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctattaggactg
tttgctgacggcaatatgccagtgcgctggcaaggaccgaaagcaacgtaccacggtaat
atagataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagtgtaccgacc
ctggcgcagatgaccgacaaagccattgaattgttgagtaaaaatgagaaaggctttttc
ctgcaagttgaaggtgcgtcaatcgataaacaggatcacgctgcgaatccttgtgggcaa
attggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattcgctaaaaag
gatggtaacacgttggtcatagtcaccgctgatcacgcccatgccagccagatagttgcg
ccagataccaaagctccgggcctcacccaggcgctaaataccaaagatggcgcagtgatg
gtgatgagttacgggaactccgaagaggattcacaagaacataccggcagtcagttgcgt
attgcggcgtatggcccgcatgccgccaatgttgttggactgaccgaccagaccgatctc
ttctacaccatgaaagccgccctggggctgaaataa

DBGET integrated database retrieval system