KEGG   Enterobacter ludwigii EN-119: BH714_02080Help
Entry
BH714_02080       CDS       T04719                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
elg  Enterobacter ludwigii EN-119
Brite
KEGG Orthology (KO) [BR:elg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BH714_02080
Enzymes [BR:elg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BH714_02080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 FAD_binding_3 Thi4 K_oxygenase Glutaredoxin AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AOT42166
UniProt: A0A5M3V5E0
LinkDB All DBs
Position
454806..456371
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPNVTFKEDNGLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFMNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYEVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVALAGIFVQIGLLPNTTWLDGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaatatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgctacgctggacgacagcgctaaatcggcagagatcaaggaactgctg
gcagagatcgccgaactgtcaccgaacgtgaccttcaaagaagataacggtctggcggtg
cgcaagccctccttcctgatcaccaatccgggttctgaccaggggccgcgttttgccggt
tctccactgggccacgaattcacctcgctggtgctggcactgctgtggaccggtggtcat
ccgtcaaaagaggcgcaggcgctgctcgagcagatccgcgacattgacggcgattttgag
tttgaaacctattactcactctcctgccataactgcccggacgtggtgcaggcgctgaac
ctgatgtcggtgctgaacccgcgcattaagcatacggcgattgacggcggtacgttccag
aacgaaatcaccgaccgtaacgtcatgggcgttccggcggtctttatgaacggtcaggag
tttggccagggccgtatgacgctgaccgaaatcgttgccaaagtggacacgggtgccgaa
aaacgtgcggcagaagcgctgaacaaacgtgacgcgtatgatgttctgattgtcggctcc
ggcccggcgggcgcggcggcggcggtttactccgcccgtaaaggcattcgtaccggcctg
atgggcgaacgcttcggtggccaggtgctcgacaccgtggatatcgaaaactacatctct
gtgccgaagaccgaaggccagaaactggctggcgcactgaaggcgcacgtcagcgattat
gaagtggatgtgatcgacagccagagcgccagcaagctggttccggccgcggttgaaggg
gggttacaccagattgaaaccgcctccggcgcggtgctgaaagcgcgcagcattatcatt
gccaccggcgccaaatggcgcaacatgaacgtcccgggtgaagatcagtatcgcaccaaa
ggcgtcacctactgcccgcactgcgacggcccgctgtttaaaggtaaacgcgtggcggtg
atcggcggcggtaactccggtgtggaagcggcgattgacctggcgggtatcgttgaacac
gtcaccctgctggagttcgccccagaaatgaaagcggaccaggtgctgcaggacaaagtg
cgtagcctgaaaaacgtcgatatcgtgctgaatgcgcagaccacggaagtgaaaggtgac
ggcagcaaagtgaccggtctggaataccgcgaccgcgtgagcggtgacgtgcatagcgtg
gcgctggcggggatcttcgtacagattggtctgttgccaaacaccacctggctggacggc
gcgattgagcgcaaccggatgggcgaaattattatcgatgcgaaatgcgaaaccagcgtg
aaaggggtgttcgcggcaggggactgcaccacggttccgtacaaacagatcatcattgcc
accggtgaaggggcgaaagcgtctctgagctcgttcgattatctgattcgcaccaaaacg
gcataa

DBGET integrated database retrieval system