KEGG   Enterobacter ludwigii EN-119: BH714_06430Help
Entry
BH714_06430       CDS       T04719                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
elg  Enterobacter ludwigii EN-119
Pathway
elg00480  Glutathione metabolism
elg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BH714_06430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elg02000]
    BH714_06430
Enzymes [BR:elg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BH714_06430
Transporters [BR:elg02000]
 Other transporters
  Pores ion channels [TC:1]
   BH714_06430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 Tom37 GST_C_3 GST_N_4 GST_C_5 EF-hand_12
Motif
Other DBs
NCBI-ProteinID: AOT42946
LinkDB All DBs
Position
1341465..1342139
Genome map
AA seq 224 aa AA seqDB search
MSTHDLTLISHPLCPFVQRSAIVLLEKNVPFDRVNVDLSAKPDWFLALSPTGKVPLLKVH
HAEGEDAIIFESMVICEYLNETQDGDSLYADDALERARQRAWIEFSTLMLGNAWQFLNAT
DQAMADSKRAVLREQLEYIESELNSGPYFSGSKFSMVDAIYAPVFRYFSIIDASVSEAIF
EGLPRISAWKTALAKRESVNAAVSPDYAELFQNHLRQHSAILAA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtctacccatgacctgacactgattagccacccattgtgtccctttgtgcagcgttca
gcgatcgttcttctcgaaaaaaatgtgccatttgaccgtgtaaatgtagatctgtcggcg
aagcctgactggtttcttgctctgtcacccaccggcaaggtaccgctacttaaagtgcat
catgcagagggcgaagatgccattatttttgagagcatggtgatctgcgagtatcttaat
gaaacgcaagatggtgattcgctgtatgctgacgatgcattagaaagggctagacagcga
gcatggatcgagttctctacattaatgcttggaaatgcctggcaatttttaaatgcgact
gatcaggccatggcagacagcaaacgcgctgtgctccgtgagcaacttgaatatattgaa
tctgaattgaattcagggccttatttctcgggttccaaatttagtatggttgatgcgatc
tacgctcctgttttccgttacttctccatcattgatgcatcagtatctgaggcgattttt
gagggacttccgcggatttccgcatggaaaactgcacttgcgaaaagggaaagcgtaaat
gccgctgtatcaccagattatgcagaacttttccaaaatcatcttcgtcagcattctgca
attctcgctgcctga

DBGET integrated database retrieval system