KEGG   Enterobacter ludwigii: BH714_14005Help
Entry
BH714_14005       CDS       T04719                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
elg  Enterobacter ludwigii
Pathway
elg00250  Alanine, aspartate and glutamate metabolism
elg00410  beta-Alanine metabolism
elg00640  Propanoate metabolism
elg00650  Butanoate metabolism
elg01100  Metabolic pathways
elg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BH714_14005
   00650 Butanoate metabolism
    BH714_14005
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BH714_14005
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BH714_14005
Enzymes [BR:elg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BH714_14005
Amino acid related enzymes [BR:elg01007]
 Aminotransferase (transaminase)
  Class III
   BH714_14005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOT46073
LinkDB All DBs
Position
complement(2975198..2976403)
Genome map
AA seq 401 aa AA seqDB search
MCNFYADKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPKVIAAIEKQLHAFTHTAYQIV
PYEGYVALAERINQRVPVDGPAKTAFFSTGAEAVENAVKIARAYTRRPGLIAFGGAFHGR
TFMTMALTGKVAPYKLGFGPFPGSVYHAHYPNDLYGVSTAEALKSLERIFKADIAPDQVA
AIILEPVQGEGGFNIAPADFMQALRELCDTHGILLIADEVQSGFARTGKLFSMEHHCVKP
DLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGNPLAIAAAHAVLDVIDEEDLC
TRAAHLGHHLVEVLNKAKGDCPFIADIRAQGSMVAVEFNDPQTGLPSPEFTRQVQERALQ
EGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDIISASLTR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacttctacgccgataaagccgaaaatgccacggtgtgggacgtcgagggcaac
gagtatatcgacttcgccgccgggatcgcggtgctgaataccggccatcggcatccaaaa
gttattgccgccatcgaaaaacaactccacgcatttacccatacggcatatcagattgtc
ccgtacgaaggctatgtggcgcttgccgagcgtatcaaccaacgtgtacccgttgatggg
cctgccaaaacggctttcttctctacgggagcagaggcggtcgaaaacgcggtaaaaatt
gcccgcgcgtatacccgtcgtcctggcctgatcgcctttggcggtgccttccacggccgt
acctttatgacgatggcgttgacggggaaagtggcgccgtacaaactcggtttcggtccg
tttcccggatcggtttatcacgcccactatccaaatgatctgtacggcgtcagcacggca
gaagcgttaaaaagcctcgaacgcatcttcaaagcagacattgcgccggaccaggtggcg
gccattatcctggaaccggttcagggggagggggggttcaacattgcccccgccgatttt
atgcaggccctgcgcgaactgtgcgatacgcacggaattttgctgattgccgatgaagtg
caaagtggctttgcgcgaaccggcaagctgttctcgatggaacaccattgcgtgaagccg
gatctgatcaccatggcgaaaagcctggccggcgggatgccgctctcggcggtctctggc
cgggcggaagtgatggatgcccccgcacctggcgggctgggcgggacttacgccggcaac
ccgctggcgattgccgcagcccatgccgtgctggatgtgattgatgaagaggatctctgc
acgcgcgcggcgcatcttggccatcatctggtggaagtgctgaacaaagcgaagggcgac
tgtccgtttatcgctgatattcgtgcccagggctcaatggtggcggtggaatttaacgac
ccgcaaaccgggctgccgtcgcctgaattcacgcgtcaggtccaggagcgtgcgttgcag
gaaggtctattgctgctgagctgcggcgtgtacggcaacgttatccgtttcctctatccg
cttaccatccccgaagttcagttccgtaaagcgctggatattatctccgcgtcgctgaca
cgttaa

DBGET integrated database retrieval system