KEGG   Enterobacter ludwigii: BH714_14545Help
Entry
BH714_14545       CDS       T04719                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
elg  Enterobacter ludwigii
Pathway
elg00620  Pyruvate metabolism
elg00680  Methane metabolism
elg01100  Metabolic pathways
elg01120  Microbial metabolism in diverse environments
elg01200  Carbon metabolism
Module
elg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:elg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BH714_14545
  Energy metabolism
   00680 Methane metabolism
    BH714_14545
Enzymes [BR:elg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BH714_14545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOT44386
LinkDB All DBs
Position
3092697..3095348
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPDLNED
IIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYERNQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLDYRLPVDF
VPVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIQVLISELSMVEATPELR
ALAGEEGASEPYRFLMKKLRGQLMATQAWLEARLKGQRLPKPEGLLSQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDVRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNETREVLNTCKAIVDAPKGSVAAYVISMAKTP
SDVLGVHLLLKEAGIDYALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKESWCHIMDEL
SDISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQNELETMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVKPELWTLGKELRELLEDDIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLAEEEGKEPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgcttgga
gataccatcaaagatgcgttgggggaaaacatcctcgaccgcgttgaaaccatccgcaag
ctgtcaaaatcttcccgtgcaggtaacgaggccagtcgtcaggagctgctcaccaccttg
cagaacctttctaacgatgagctgctgcccgttgcccgcgccttcagccagtttctgaac
ctggcaaacaccgctgagcaataccacagcatttcgccgaatggcgaagctgccagcaac
ccggaagtcattgcccgtacgcttcgtaaactgaaagaccaaccagacctcaacgaagac
atcatcaaaaaagcggtggagtccctttcgctggagctggttctgaccgctcacccaacc
gaaatcactcgccgcaccctgatccacaaaatggtggaagtgaacaactgcctcaagcag
ctggataacaaagacattgctgactacgaacgcaaccagctgatgcgccgtctgcgccag
ctgattgcccagtcctggcacaccgatgaaattcgtaagcatcgtccaagcccggtcgac
gaagccaaatggggctttgcagtagtggaaaatagcctgtgggaaggggtgccgaactac
ctgcgtgaactgaacgagcagctggaagcgaatctggattaccgcctgccggtcgatttt
gtgccggtgcgcttcacctcctggatgggcggcgaccgtgacggcaacccgaacgtcacc
gcggaaattacccgccacgtgcttctgttgagccgctggaaagcaaccgacctgttcctg
aaagatattcaggtattgatctccgagctgtcgatggtagaggccacgccggaactgcgc
gcgctggccggcgaagaaggtgccagcgagccgtatcgtttcctgatgaaaaaactgcgt
ggccaactgatggcgacgcaggcctggctggaagcgcgtctgaaaggccagcgcctgcca
aagccggaaggcctgctgagccagaacgagcagctctgggagccgctgtatgcctgctat
aaatcactgcaggcctgcggaatgggcatcatcgcgaatggcgaactgctcgacaccctg
cgtcgcgtgaagtgtttcggcgtgccgctggtgcgtattgacgtccgtcaggaaagcacc
cgtcataccgaagcgctgggcgaactgacccgctatctcggcatcggcgactatgaaagc
tggtccgaagcggacaaacaagccttcctgatccgtgaactgaactccaagcgtcccctg
ctgccacgtaactgggaaccaagcaacgaaacccgcgaggtgctcaacacctgtaaagcg
atcgttgatgcgccgaaaggatcggtggctgcctatgtgatctccatggcgaaaacgccg
tctgacgtgctgggcgttcaccttctgctcaaagaagccggtatcgactatgcccttccg
gttgcaccgctgtttgaaacccttgatgacctgaacaacgccaacgacgtcatgacgcag
ctgctgaacatcgactggtaccgcggctttattcagggcaaacagatggtgatgattggc
tattccgactccgcaaaagacgcgggcgtcatggcggcatcctgggcgcagtatcaggca
caggacgcgttgatcaagacctgtgaaaaagcaggcatcgaactgacgctgttccacgga
cgcggtggctcgattggccgtggtggtgcgccagcgcatgcggcactgctgtcacaaccg
ccgggaagcctgaaaggcggcctgcgtgtgaccgaacagggcgaaatgatccgcttcaag
tacggcctgccggaagtgaccatcagcagcctgtcgctctacactagtgcgattctggaa
gcgaacctgctgccaccgccagagccgaaagagtcctggtgccatatcatggacgagctg
tcagatatctcctgcgatctgtaccgcggctacgtgcgtgaaaacaaagattttgtgcct
tacttccgttcagctacccctgagcaggagctgggtaaactgccgctgggttcacgtccg
gctaaacgccgcccgaccggtggcgtagagtctctgcgtgccatcccgtggatcttcgcc
tggacccagaaccgtctgatgctgcccgcctggctgggcgcaggcgcggcgctgcagaaa
gtggtggaagatggcaaacagaacgaactggaaaccatgtgccgcgactggccgttcttc
tccacccgtctgggtatgctggagatggtcttctcgaaagcagacctgtggctggcggaa
tactacgatcagcgtctggtgaagcctgagctgtggacgctgggtaaagagctgcgcgaa
ctgctggaagacgacatcaaagtggtgctggatattgctaacgactcgcacctgatggcg
gatctgccgtggattgccgagtccatccagctgcgtaacatctacaccgaccccctgaac
gtcctgcaggcggagctgctgcaccgttcacgtctggcggaagaagaaggtaaagagccg
gatccacgcgtcgaacaggcgttgatggtgacgattgcaggcgttgcggcaggtatgcgt
aacacaggctaa

DBGET integrated database retrieval system