KEGG   Enterobacter ludwigii EN-119: BH714_14820Help
Entry
BH714_14820       CDS       T04719                                 

Definition
(GenBank) formate dehydrogenase accessory protein FdhE
  KO
K02380  FdhE protein
Organism
elg  Enterobacter ludwigii EN-119
Brite
KEGG Orthology (KO) [BR:elg00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BH714_14820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FdhE Stc1 zf-ribbon_3 Zn_Tnp_IS1595 zinc_ribbon_6
Motif
Other DBs
NCBI-ProteinID: AOT44438
LinkDB All DBs
Position
3150893..3151822
Genome map
AA seq 309 aa AA seqDB search
MSIRIIPQDELGSSEKRTAEYIPPLLFPRLKNLYNRRAERLRELAENNPLGDFLRFAALV
AHAQEVVLYDHPLQIDLTARIKEASEQGKPPLDIHVLPRDKHWHTLLHSLIAELKPEMSG
TALAVIENLEKASDQELEEMASALFASDFSLVSSDKAPFIWAALSLYWAQMASLIPGKAR
AEYGEARQFCPVCGSMPVSSMVQIGTTQGLRYLHCNLCETEWHVVRIKCSNCEQTRDLNY
WSLENEDAAVKAESCGDCGTYLKILYQEKDPKVEAVADDLASLILDAKMEQEGFARSSIN
PFLFPGEGE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcgcataatcccgcaagatgagctgggttcgagcgagaaacgcacggcggaa
tatattccgccgttgttattccccagactcaagaacctctataaccgccgcgcagagcgt
ctgcgcgagctggcagagaacaacccactgggtgattttctgcgttttgccgcgctggtt
gcccatgcgcaggaagtggtgctgtacgaccacccgctgcaaattgacctgaccgcgcgc
atcaaagaggccagcgagcagggtaagcctccgctggatatccacgttctgccgcgcgat
aagcactggcatacgctgctgcactccctgattgccgagctgaaacccgagatgagcggt
accgcgctggcggtcattgagaatctggaaaaagcctccgatcaggagctggaagagatg
gcgagcgcgctgtttgcgtccgatttctccctggtcagcagcgacaaagcgccgttcatc
tgggcagcgttgtcgctttactgggcgcaaatggccagcctgatcccgggtaaagcccgt
gccgaatacggtgaagcgcgtcaattctgcccggtatgcggctcaatgccggtgtccagc
atggtgcagatcggtaccactcaggggctgcgttatctgcactgcaacctgtgtgaaacc
gagtggcacgtggtgcgcattaaatgcagcaactgcgagcagacgcgcgatctcaactac
tggtcgctggaaaatgaagacgcggcggtcaaagctgaaagctgcggcgactgcggtacc
tacctgaagatcctttatcaggaaaaagacccgaaagtcgaagccgtcgccgacgatctc
gcctcgctgattctggacgccaaaatggagcaagagggctttgcccgcagctctattaac
ccgttcctgttcccgggtgaaggggagtaa

DBGET integrated database retrieval system