KEGG   Enterobacter ludwigii: BH714_16185Help
Entry
BH714_16185       CDS       T04719                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
elg  Enterobacter ludwigii
Brite
Translation factors [BR:elg03012]
 Eukaryotic Type
  Elongation factors
   BH714_16185
 Prokaryotic Type
   BH714_16185
Mitochondrial biogenesis [BR:elg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BH714_16185
Exosome [BR:elg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BH714_16185
  Exosomal proteins of breast cancer cells
   BH714_16185
  Exosomal proteins of colorectal cancer cells
   BH714_16185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AOT44684
LinkDB All DBs
Position
3440026..3441210
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcaccagaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgagtacgacaccccgactcgccactacgcacacgta
gactgcccaggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgccaggtaggcgttccttacatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagagctgctggaactggtagagatggaagttcgtgaactgctgtctcag
tacgatttcccaggcgacgacactccaatcgttcgtggttccgcgctgaaagcgctggaa
ggcgacgctgagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccagaaccagagcgtgcgatcgacaagccgttcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgttgagcgcggtatcatcaaagttggc
gaagaagttgaaatcgttggtatcaaagagactgctaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccaggctcaatcaag
ccacacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
actatcgaactgccagaaggcgttgagatggtaatgccaggcgacaacatcaagatggtt
gtgacgctgatccacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggt
ggccgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system