KEGG   Enterobacter ludwigii: BH714_17275Help
Entry
BH714_17275       CDS       T04719                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
elg  Enterobacter ludwigii
Pathway
elg00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BH714_17275
Enzymes [BR:elg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BH714_17275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_2_C Cellulase Glyco_hydro_42C Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: AOT44872
LinkDB All DBs
Position
3673470..3675479
Genome map
AA seq 669 aa AA seqDB search
MSDLYYGVAYYDEYMPEDRLAQDIALMRETGINVVRIAESTWSTLEPQEGEYHFYHIDRV
LNAMHQAGIAVIIGTPTYAVPAWLVAKHPDILVTTAEGQQKYGPRQIMDIVNPTFRRYAE
NILRTLMAHVQNHPAIIGWQLDNETKHYDNVGRYMQEGFVRSLQEKYPSLDRLNRDFGLD
YWSNRIDSWDDFPPVENTINASLACAFSRYQRQQVTEYLAWQAEIVREYAQPHQFVTHNF
DFEWRGYSFGVQPRVDHFAAAKALDIAGVDIYHPSQKHLTGREIAFGGAITRGLKGGNNY
FVLETQAQGFAQWTPFPCQLRLQAFSHVASGAAMVSYWHWHSIHNSFETYWKGLLSHDFS
RNATWQEATTIGADFARLSPQLAGLRAENDVALLINNEAMDALNQFRPGDAQGNVYNDIF
RRFHDALYDHNIALDIINDVTEVTSRYKTLIVPGLYAADDGLLTRINRYVEQGGRALIGF
KSGFSDENVKVRSSVQPGILHSACGVTYSQFTLPEDVTVAACTSTLDCREHNAAELWMEL
LTPAPGTRMLLRYQHPAWSEYAAATEADYGKGRALYVGFLPHKALISQLFDTLTDGLELR
SRSSAYRYPLITRTLRNRDGKRIHFLFNYSGDSQEMLAETSGTELLSGRTVTLGEPLRLK
GWEFSIIES
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttatattacggtgtcgcttattacgacgaatatatgccggaggatcgcctt
gcgcaggacatcgcgttgatgcgagagacaggcatcaacgtggtgcgcatcgcagaatct
acctggagtacgctggagccgcaggaaggcgaatatcatttctaccacatcgaccgcgtg
ctgaacgccatgcaccaggcggggatcgcggtgattatcggtacgccgacctacgcggta
ccggcatggctggtggcgaagcaccctgacattctggtgaccacagccgaaggccagcaa
aagtacggcccgcggcagattatggacatcgtgaaccccacttttcgccgctatgcagag
aacattctccgcacattgatggcccatgtgcagaatcatccggcgattatcggctggcag
ttggataacgaaaccaagcactacgacaacgtcgggcgctatatgcaggaaggctttgtg
cgcagcttgcaggaaaaatatcccagcctcgatcggttgaaccgcgacttcggcctcgac
tactggagcaaccgcatcgacagctgggatgacttcccgccggtagaaaacaccatcaat
gccagcctcgcctgcgcgttctcgcgctatcagcgccagcaggtcactgagtatctggcg
tggcaggcagagatcgtgcgcgagtacgcgcaaccgcaccagttcgtcacccacaacttt
gatttcgaatggcgcggctattcgtttggcgtccagccgcgcgtggaccactttgctgcg
gccaaagcgctggatattgctggggtcgatatttatcaccccagccagaagcatttaacc
ggacgagaaattgccttcggcggcgccattacccgcgggctaaaaggcggcaataactac
ttcgtgctggaaacccaggcgcaaggctttgcccagtggacgccattcccctgccagttg
cggctccaggcctttagccacgtggcgtcgggcgcggcgatggtctcgtactggcactgg
cactctatccacaattcatttgaaacctactggaaggggctgctgagccatgacttttcc
cgcaacgcgacctggcaggaagcgaccaccatcggcgctgatttcgcccgactatcgcct
cagctagcggggctgcgcgcggaaaacgacgtggcgctgctgattaacaatgaagccatg
gatgcgctcaatcagttccgccccggcgacgcgcagggcaacgtctataacgatattttc
cgccgcttccacgacgcgctgtatgaccacaatatcgcactggatatcatcaacgacgtc
accgaggtgacgtcgcgctataaaacactaatcgtacccggcctgtacgccgccgatgat
ggtctgctcacgcggattaaccgctacgttgagcaaggaggacgggcgctgattggcttt
aagtcaggcttcagcgatgaaaatgtgaaggtgcgcagcagcgtgcagccgggtattctg
cacagtgcatgtggcgtcacctacagtcagttcaccctgccggaggacgtgaccgttgcc
gcctgtacttcgaccctggactgccgcgaacacaacgccgccgagctgtggatggagctg
ttaacgcctgcgccgggtacccgcatgctgctgcgctatcagcatccggcctggagcgag
tatgcggcggcgaccgaagcggactacggcaaaggccgggcgctgtacgttggcttcctg
ccgcacaaggcgctgattagccagctgtttgacaccctgaccgacgggctggaactccgt
tcgcgctcgtcagcctaccgctatccgttaattactaggaccctgcgtaaccgcgacggc
aaacgcattcacttcctgtttaactacagcggcgatagtcaagagatgctcgccgaaacc
agcggcaccgagctgttaagcggtagaacggtgacgctcggcgagccattgcgtctcaaa
ggctgggaatttagtatcattgaaagttaa

DBGET integrated database retrieval system