KEGG   Enterobacter ludwigii EN-119: BH714_18780Help
Entry
BH714_18780       CDS       T04719                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
elg  Enterobacter ludwigii EN-119
Pathway
elg00061  Fatty acid biosynthesis
elg00780  Biotin metabolism
elg01100  Metabolic pathways
elg01212  Fatty acid metabolism
Module
elg_M00083  Fatty acid biosynthesis, elongation
elg_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:elg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BH714_18780
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BH714_18780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:elg01004]
    BH714_18780
Enzymes [BR:elg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BH714_18780
Lipid biosynthesis proteins [BR:elg01004]
 Fatty acid synthase
  Component type
   BH714_18780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AOT45146
UniProt: W0BSE1
LinkDB All DBs
Position
3998730..3999185
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSRES
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcatattgaagagattttagaacttctgccgcaccgc
tacccgtttttgctggtagaccgtgtgctggattttgaagaaggtcgttttctgcgcgca
gtgaaaaatgtttccgtgaacgagccgttcttccagggacacttcccgggtaaacctatc
ttcccgggtgtgttgattctggaagcgatggcacaggctaccggtattcttgcgtttaaa
agcgtgggcaaactggagccgggtgagctgtactacttcgcgggtatcgatgaagcgcgc
ttcaagcgtcctgtcgtgcctggtgatcagatgatcatggaagtcacttttgaaaaaacg
cgtcgcggcctgactcgcttcaaaggcgtagctctggttgacggcaaagttgtttgcgaa
gcgactatgatgtgtgctcgtagccgggagtcttga

DBGET integrated database retrieval system